KEGG   Bacteroides fragilis BOB25: VU15_08285
Entry
VU15_08285        CDS       T03897                                 

Definition
(GenBank) hypothetical protein
Organism
bfb  Bacteroides fragilis BOB25
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: AKA51709
UniProt: A0A1C0WS19
LinkDB
Position
complement(2118431..2119387)
AA seq 318 aa
MEHRLPKEIKGLLPPNTMDTDFKAELYGALLAEAGFDTAQIMMVRDGNNLSNVSKDIRSV
KYRNHVGIAEGTYIELKTNRRGIYDSLPEGLFHEALFPGKVKDLGLILEEMQQHSNEEFF
IRRFFSLLESEVDREGIQAQLLELRYDKKNKYSDYAKLFAACWPVIHILSGQGALLFIKF
MPHIHSIRGRLEEVSDALSQILEAPVKVRPKMVQRTIRAQKPNRLGNMRLGANSVNVGVL
NSAEADLHIHISDLPTREVERFLPGNRSRKALEMLADIFLGAWQEFDVTVSVSPDERKTY
LKPTGDASPCYLGINTYL
NT seq 957 nt   +upstreamnt  +downstreamnt
atggaacatcgcttacccaaagagataaaggggcttcttccgcccaatacaatggacacc
gacttcaaggcagagctatacggagccttgctagcggaagccgggttcgacaccgctcaa
attatgatggtgcgtgacggtaataacctgagcaatgtttcgaaagatatccgatcggtg
aagtacagaaatcatgtcgggatagcggaggggacatacatagaactaaagaccaaccgc
cgggggatttatgattcgctgccggagggattgttccatgaggcgctctttcccggcaag
gtgaaagatttgggacttattctggaagagatgcaacaacatagtaacgaagagttcttt
atccgccgttttttcagcctgctggagagcgaagtggacagagaagggatacaggcacaa
ttgctcgaattgcggtacgataaaaagaacaaatattctgattatgcgaaactctttgcc
gcttgctggccggtcattcatattttgtccggacagggggcgttgctgttcatcaagttc
atgccgcatatccattcgatccggggcagactggaagaggtaagcgacgcactgtcgcag
attctggaagctccagtaaaggtacgcccgaaaatggtgcaacggacaataagggcgcaa
aaaccgaaccggttggggaacatgagactgggagcaaacagtgtgaatgtgggggtgctt
aatagtgcggaagctgatttgcatatacacataagcgacctgccaacacgggaagtcgaa
aggttcctgcccggcaaccgctcccgcaaagctcttgaaatgctggcggatatttttctt
ggtgcgtggcaggagttcgatgtgacggtcagcgttagtcctgacgaacgcaagacttat
ttaaaaccgacgggtgacgccagtccgtgttacctcggaataaacacttatttataa

DBGET integrated database retrieval system