KEGG   Bacteroides fragilis BOB25: VU15_11000Help
Entry
VU15_11000        CDS       T03897                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bfb  Bacteroides fragilis BOB25
Brite
Enzymes [BR:bfb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VU15_11000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AKA52181
UniProt: A0A0K6BVG6
LinkDB All DBs
Position
2750842..2751459
Genome map
AA seq 205 aa AA seqDB search
MNTLLMSLIFTTMTYEMPKLPYANNALEPVISQQTIDYHYGKHLQTYVNNLNSLVPGTEY
EGKTVEAIVASAPDGAIFNNAGQVLNHTLYFLQFAPKPAKNEPAGKLGEAIKRDFGSFEN
FKKEFNAASVGLFGSGWAWLSVDKDGKLHITKEPNGSNPVRAGLKPLLGFDVWEHAYYLD
YQNRRADHVNKLWEIIDWDVVEKRL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaatacattattaatgtctttaatatttacgaccatgacttacgaaatgcctaaactt
ccgtacgcaaacaatgcgctggaacctgtaatcagtcagcaaaccatcgattaccattat
ggtaaacatcttcaaacatatgtaaacaatctcaatagcctggttccgggcaccgaatat
gaaggaaaaacagtagaagccatcgtagcctcggctcccgacggagctatcttcaataat
gccggacaggtgctgaaccatactctgtacttcctgcaatttgcgccgaaaccggcaaag
aacgaaccggcaggcaagttgggagaagccatcaaacgcgacttcggcagctttgaaaac
ttcaagaaagagttcaacgcagcttctgtaggattgttcggttcgggatgggcctggctg
tccgttgacaaagacggaaagctgcacatcaccaaagagcccaacggaagcaatccggta
cgcgcgggactgaaaccgttactgggatttgacgtatgggaacatgcttactacctcgac
tatcagaaccgtcgtgccgaccacgtaaacaaactgtgggagatcatcgactgggatgtc
gtagaaaaacggctgtaa

DBGET integrated database retrieval system