KEGG   Bacteroides fragilis 638R: BF638R_0872Help
Entry
BF638R_0872       CDS       T01691                                 

Definition
(GenBank) putative alanine racemase and UDP-N-acetylmuramoylalanyl-D-glutamyl, 6-diaminopimelate-D-alanyl-D-alanyl ligase fusion protein
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bfg  Bacteroides fragilis 638R
Pathway
bfg00473  D-Alanine metabolism
bfg01100  Metabolic pathways
bfg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bfg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BF638R_0872
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BF638R_0872
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bfg01011]
    BF638R_0872
Enzymes [BR:bfg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BF638R_0872
Peptidoglycan biosynthesis and degradation proteins [BR:bfg01011]
 Precursor biosynthesis
  Racemase
   BF638R_0872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C LodA_C
Motif
Other DBs
NCBI-ProteinID: CBW21445
UniProt: E1WLT1
LinkDB All DBs
Position
complement(1061467..1063989)
Genome map
AA seq 840 aa AA seqDB search
MQICQCFNIMSYTIESIVEKIGARRLGNKPAAIDWLLTDSRSLCFPEETLFFAIPTKRNN
GARYIPDLYERGVRNFVVTSEDFKGLTMDSEQLKVTMAQECNFLIVPNTLKALQKLAEQH
RGSFQIPVVGITGSNGKTIVKEWLHQLLSPDRVIVRSPRSYNSQIGVPLSVWQMNEESEL
GIFEAGISEMGEMRPLQNMIKPTIGILTNIGGAHQENFFSLQEKCMEKLSLFKDCDVVIY
NGDNEMISNCVGKSMLTAREIAWSMRDIERPLYISRVEKKEDHTVISYRYLEMDNTFCIP
FIDDASIENSLNCLAACLYLMVPADQITERMARLEPVAMRLEVKDGKNNCILINDSYNSD
LASLDIALDFLYRRSQSKGLKRTLILSDILETGQSTTTLYRKVAQLVHSRGIEKIIGVGA
EISSCASKFDIEKYFFPDTKALLASDVIKKLRNEIILIKGSRNFGFDLVSEELELKVHET
ILEVNLGAMVANLNHYRSMLKPETKMVCMVKASAYGAGSYEIAKTLQEHHADYLAVAVAD
EGSDLRKAGITASIIIMDPELTAFKTMFDYKLEPEVYNFHLLDALIKAAEKEGITNFPIH
VKLDTGMHRLGFEEKDIPQLIRRLKNQNALIPRSVFSHFVGSDSAQFDAFTRQQIERYEK
MSKELQDAFPHKILRHICNTAGIERFPGAQFDMVRLGIGLYGISPIDNSIINNVSTLKTT
ILQIRDVAEEDTVGYSRKGHLIRPSRIAAIPIGYADGLNRHLGCGHGYCLVNGKKAPYVG
NICMDVCMIDVTDIDCREGDQAIIFGDELPITVLSDALETIPYEVLTGISTRVKRVYYQD
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaatatgccaatgctttaatattatgtcatatacaattgaatcaatcgttgaaaaa
ataggtgcacggcgtctgggaaacaagcctgctgccatcgactggctactgactgacagc
cgttcgttatgctttccggaagagaccctcttttttgccattcctactaaaaggaacaac
ggcgcacgctatatccctgacctttatgaacggggagtgcgcaattttgtagtcacaagc
gaagatttcaaagggctcaccatggacagtgagcaactaaaagtgacaatggctcaggaa
tgcaatttccttattgtccccaatactttaaaagcacttcagaaattggccgaacaacac
cgtggttccttccagattccggtagtcggcattacgggcagcaatggaaagaccattgta
aaagaatggcttcaccaattgctcagccccgaccgggttatcgtgcgttcaccgcgcagc
tacaattcgcaaatcggtgtcccgctgtcagtctggcaaatgaacgaggaatccgaactg
ggcattttcgaagccggcatttcggaaatgggcgaaatgcgtccgttacagaatatgatt
aagccgacaataggcatcctgaccaacattggcggagcacatcaggaaaacttcttttct
ctgcaagagaagtgcatggaaaaactaagcctgtttaaagattgcgacgtagtcatttac
aatggcgacaacgaaatgataagcaactgcgtaggaaagtcaatgctgactgcccgtgaa
atcgcatggagcatgagggatatcgaacgtccgctctatatcagcagggttgagaagaaa
gaagatcataccgtcatctcctaccgctatctggagatggacaatacgttctgtattccc
tttatcgatgatgcttccatagagaactcactgaactgcctcgctgcctgcctgtacctg
atggtaccggccgaccagatcaccgaacgaatggcccggctcgaacctgtagcgatgcgc
cttgaagtaaaagacggaaagaacaactgtatcttgatcaatgacagttataattcggac
cttgcttcgctggatatcgctctcgactttctttaccggcgttcgcagtcaaaaggccta
aagcgcactttgatcctttcggatatcctggaaaccggacaaagcacgacaacactctac
cgcaaagtggcacaactggttcacagccgcggcattgaaaagattatcggtgtaggtgcc
gaaatatcctcatgcgcatcaaagtttgatatagaaaaatatttcttccccgataccaag
gcacttctggcatcagatgtaattaagaaactcagaaatgaaatcatcctgataaaaggc
tcccgcaacttcggtttcgacctcgtttcggaagaactggaactgaaagtacacgaaacc
atcctggaagtaaacctgggagctatggtagccaacctgaatcactaccgctcgatgctc
aaaccggaaactaaaatggtgtgcatggtgaaagcgtctgcttatggagcaggttcgtac
gaaatagccaaaacccttcaggaacatcacgctgactatctggcagtggccgtagccgat
gaaggttccgaccttcgcaaagcagggatcacagcctccattatcatcatggatcccgaa
ctgaccgctttcaaaaccatgttcgactataaactggaaccggaagtatacaatttccat
ttactcgacgcattgataaaagccgccgaaaaagaaggtatcaccaacttccccattcac
gtaaaactggatacgggtatgcaccgattgggattcgaagagaaagacatcccgcaactg
attcgccggttaaagaaccagaatgcactgatcccccgctctgtcttttcccatttcgta
ggcagtgattctgcccagttcgacgcttttacccggcagcaaatagaacgatatgaaaag
atgtcaaaggaactgcaagatgcattcccgcacaaaatactgcgccatatctgcaacaca
gccggtatcgaacgcttccccggtgcacagttcgacatggttcgtcttggcatcggactg
tatggaatcagtccgatcgataactcaatcatcaacaacgtgagtaccttgaaaacaacg
attctccaaatacgggacgtggcggaagaagatactgtaggttatagccgcaaagggcat
ctgatacgcccctcacgtatcgctgctatacccatcggatatgccgacggcctgaaccgc
catttgggatgcggacatggctattgccttgtcaatggcaaaaaagccccatacgtagga
aatatctgcatggatgtgtgcatgatcgacgtaacggatattgattgtagagaaggtgat
caagctatcatcttcggtgacgaattaccgattaccgtcttatcggatgcgctcgaaacc
atcccttatgaagtattgacaggcatttcaacccgggtcaagagagtatattatcaagat
taa

DBGET integrated database retrieval system