KEGG   Bacteroides fragilis 638R: BF638R_1205Help
Entry
BF638R_1205       CDS       T01691                                 

Gene name
susB
Definition
(GenBank) putative alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
bfg  Bacteroides fragilis 638R
Pathway
bfg00500  Starch and sucrose metabolism
bfg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BF638R_1205 (susB)
Enzymes [BR:bfg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BF638R_1205 (susB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: CBW21755
UniProt: E1WQY7
LinkDB All DBs
Position
1450174..1452345
Genome map
AA seq 723 aa AA seqDB search
MNHIMKNMKKLTFKLACFFLSLLVSSVAMAESITSPNGLLKLNVSVNEKGQPVYELSYKG
KEVIKPSKLGLELKDDPGLMDGFTLSDAKTSSFDETWEPVWGEVKQIRNNYNELAITLDQ
KAQDRKMVIRFRLYNDGLGFRYEFPQQKNLNYFVIKEEHSQFAMAGDHTAFWIPGDYDTQ
EYDYTRSKLSEIRGLMKTAVTPNASQTPFSPTGVQTALQMKTDDGLYINLHEAALVDYSC
MHLNLDDKNFVFESWLTPDAQGTKGYMQTPCHSPWRTVMVSDDARDILASKLTLNLNEPC
KLEDTSWIKPVKYVGVWWEMITGKSTWAYTDDVYSVKLGETDYTKTKPNGRHGANNENVK
RYIDFAAEHGFDQVLVEGWNEGWEDWFGKSKDYVFDFVTPYPDFDVKMLNEYARSKGVKL
MMHHETSASVRNYERHMDEAYQFMEDNGYNAVKSGYVGNIIPRGEHHYGQWLNNHYLYAV
KKAADHKIMVNAHEAVRPTGLCRTYPNLIGNESARGTEYEAFGGNKPFHTTLLPFTRLIG
GPMDYTPGIFDTQLSFLSGEHSFVHTTLAKQLALYVTLYSPLQMAADLPESYERYMDAFQ
FIKDVAVDWDESKYIEAEPGEYITVARKAKNTNNWFVGGITGENARTSTFVLDFLEPGKQ
YVATLYADGKDADYEKNPTSYQIKKGLVTYKTKISTDLARSGGFAISLIEATPADKKALK
KWK
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccatatcatgaagaacatgaaaaaactgacttttaagttagcttgcttttttctc
tctcttttagtgagtagtgtggcaatggccgaaagtattacttctcccaacggactcttg
aaactgaatgtatctgtgaacgagaaggggcaacctgtgtatgaactttcttataaaggt
aaagaagtgattaaaccttctaaactgggtcttgaactgaaagacgatccggggttgatg
gacggttttacgttgtctgatgccaaaacttcttcttttgacgagacttgggagcctgtt
tggggcgaggttaagcaaattcgcaataattataatgaacttgcgattactttagaccag
aaagctcaggatcgcaaaatggtgattcgttttcgtctgtataatgacggactcggattt
cgctacgaatttccacaacaaaagaatctgaattattttgtaattaaagaggaacattct
caatttgctatggccggtgatcatactgctttctggataccgggagattatgatacgcag
gaatatgattatactcggtcgaaactttctgaaatacgcggcttaatgaagacggctgtc
actcccaatgcttctcaaactcctttttctcctaccggtgtacagactgctttgcagatg
aaaacagacgacgggttgtatatcaatctgcacgaagctgctttggtggattattcttgc
atgcatctcaatctggacgataagaattttgttttcgaatcgtggttgactcctgatgcc
caagggaccaaaggatatatgcaaactccttgccactctccatggcgtacggttatggtt
agtgatgatgcgcgtgatattcttgcttctaaattaacattaaatctgaacgagccttgc
aaactggaggatacttcctggattaagcctgtaaaatacgtaggtgtatggtgggaaatg
attaccggaaagagtacttgggcttatacggatgatgtttattcagtgaagttgggcgaa
accgattatactaaaactaagcctaatggtcgtcatggtgccaataatgagaacgtgaaa
cgttatattgattttgctgccgaacacggttttgatcaggtgttggtcgagggctggaat
gaaggctgggaagattggttcggcaagtcaaaagactatgtgttcgacttcgttactccg
tatcctgattttgatgtgaaaatgttgaatgagtatgctagaagtaaaggagtgaagctg
atgatgcatcatgagacttctgcatctgtgcgtaactatgaacgtcatatggatgaagct
tatcaatttatggaagataacggttacaatgcggtgaagagtggatatgttggcaatatc
atcccgcgtggtgaacaccactacggtcaatggctgaataatcattatctgtatgcggtg
aagaaagctgcggatcataaaattatggtgaatgcacacgaggctgttcgccctaccgga
ttgtgccgtacatatccgaatctgattggtaatgaatctgcccgtggtacagaatatgaa
gccttcggaggcaataagcctttccatactacgttgcttccatttacgcgtctgataggt
ggtccgatggattatactccgggtattttcgatactcaactctctttcctgagtggtgag
catagttttgtacatactactttggccaaacagttggctttgtatgtcactctttatagc
ccattacagatggctgccgatcttccggagagttatgaacgctatatggatgcctttcag
tttattaaagatgtagcagtagactgggatgaaagtaagtatattgaagcagaaccggga
gagtacatcactgtggcccgtaaagctaaaaacaccaataattggttcgttggaggaatt
actggtgaaaatgcacgcacatctacgtttgtacttgatttcctggaaccgggaaagcaa
tatgtagctactttatatgccgatggtaaagatgcggattatgaaaagaatccgacttct
tatcagattaaaaaaggtctggtgacttataagacgaagatttccactgacttggcccgt
agtggaggttttgctattagtttgatagaggctacccctgccgataagaaagcacttaaa
aagtggaaataa

DBGET integrated database retrieval system