KEGG   Bacteroides fragilis 638R: BF638R_2514Help
Entry
BF638R_2514       CDS       T01691                                 

Definition
(GenBank) putative hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bfg  Bacteroides fragilis 638R
Pathway
bfg00010  Glycolysis / Gluconeogenesis
bfg00051  Fructose and mannose metabolism
bfg00052  Galactose metabolism
bfg00500  Starch and sucrose metabolism
bfg00520  Amino sugar and nucleotide sugar metabolism
bfg00521  Streptomycin biosynthesis
bfg00524  Neomycin, kanamycin and gentamicin biosynthesis
bfg01100  Metabolic pathways
bfg01110  Biosynthesis of secondary metabolites
bfg01120  Microbial metabolism in diverse environments
bfg01130  Biosynthesis of antibiotics
bfg01200  Carbon metabolism
Module
bfg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bfg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF638R_2514
   00051 Fructose and mannose metabolism
    BF638R_2514
   00052 Galactose metabolism
    BF638R_2514
   00500 Starch and sucrose metabolism
    BF638R_2514
   00520 Amino sugar and nucleotide sugar metabolism
    BF638R_2514
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BF638R_2514
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BF638R_2514
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bfg04131]
    BF638R_2514
Enzymes [BR:bfg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     BF638R_2514
Membrane trafficking [BR:bfg04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    BF638R_2514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_1 Hexokinase_2 Phage_holin_3_1
Motif
Other DBs
NCBI-ProteinID: CBW23022
UniProt: E1WP67
LinkDB All DBs
Position
complement(2961085..2962293)
Genome map
AA seq 402 aa AA seqDB search
MEKNIFKLDNEQLKGIAHAFREKVEEGLNKNNAEIQCIPTFILPKATDIKGKALVLDLGG
TNYRVAIVDFSTEKPIIYPNNGWKKDMSIMKSPGYTREELFKELADLIVEIKREEEMPIG
YCFSYPTESIPGGDARLLRWTKGVDIREMVGQFVGKPLLDYLNEKNKIRFTGVKVLNDTI
ASLFAGLTDKSYDAYIGLIVGTGTNMATFIPSDKITKLDPECHVQGLIPVNLESGNFYPP
FLTAVDDTVDATSDSLGKQRFEKAVSGMYLGDILKAAFPLEEFEEKFDARKLTAIMNYPD
IHKDIYVQVAHWIYNRSAQLVAASLAGLIALLKSYNRDIHRVCLIAEGSLFWSESRKDKN
YNILVMEKLQELLRELELEDVEVHINSMDNANLIGTGIAALS
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaatattttcaaactggacaatgaacaactgaaaggaatcgcgcacgcattc
cgggagaaagtggaagagggattaaataagaataatgctgaaatacaatgtattcctacc
tttattttacctaaggcgaccgatattaaaggcaaggctttggttctggacctgggaggt
accaactatagagtggcaattgtcgatttctcaaccgaaaagccaatcatctatcccaat
aatggttggaagaaggatatgtcgattatgaagtcacctggttatacccgtgaagagttg
ttcaaagagttggccgacctgattgttgaaataaagcgggaagaggaaatgcctatcggt
tattgtttttcttatccgaccgaatcgataccgggaggcgatgcaagattgcttcgttgg
accaagggggtagacattcgggaaatggtgggacagtttgttgggaaacccttactcgac
tacctgaatgaaaaaaataaaatcagatttacaggagttaaagtgctgaatgacacgatt
gccagtttatttgccgggcttaccgacaaaagctatgatgcttatattggcctgattgta
gggacaggtacaaatatggcaacttttattccgtctgacaagataacgaagttggacccg
gaatgtcacgtacaaggcttgattccggtcaatctggaatcgggaaacttttatcctccc
ttcctgactgcggtggacgatactgttgacgcaacttctgacagtttgggtaaacagcgt
tttgagaaagcggtatccggcatgtatctgggagatatcctgaaagcagctttccctttg
gaagaatttgaagagaaatttgatgcaaggaaactgactgctattatgaattatcctgat
atacacaaagatatctatgttcaggtagcccattggatctataacagatcggcccagctc
gtcgctgcctctcttgccggattaatcgcattgctgaaatcgtataatcgagatatccat
cgggtttgtctgattgccgagggcagtcttttctggagtgaaagtcggaaagataaaaac
tataatatccttgtaatggagaaattgcaggaacttcttcgtgagcttgaactggaagat
gtcgaagttcatattaatagtatggataatgccaatctgataggaacggggattgcggca
ttatcctga

DBGET integrated database retrieval system