KEGG   Bacteroides fragilis 638R: BF638R_3074Help
Entry
BF638R_3074       CDS       T01691                                 

Definition
(GenBank) putative alpha-amylase precursor
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
bfg  Bacteroides fragilis 638R
Pathway
bfg00500  Starch and sucrose metabolism
bfg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BF638R_3074
Enzymes [BR:bfg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BF638R_3074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939 hDGE_amylase FeoB_N
Motif
Other DBs
NCBI-ProteinID: CBW23549
UniProt: E1WT49
LinkDB All DBs
Position
3589769..3591214
Genome map
AA seq 481 aa AA seqDB search
MENGVMMQYFEWNLPNDGNLWKQLKEDASHLHEIGVTAVWIPPAYKADEQQDEGYATYDL
YDLGEFDQKGTVRTKYGTKEELKEMIDELHKNHISVYLDVVLNHKAGGDFTEKFIVVEVD
PNDRTQALGKPFEIQGWTGYSFHGRKDKYSDFKWHWYHFSGTGFNDAKKRSGIFQIQGEG
KAWSEGVDNENGNYDFLLCNDIDLDHPEVVTELNRWGKWVSKELNLDGMRLDAIKHMKDK
FIAQFLDAVRSERGDKFYAVGEYWNGDLNTLDAYIKSVGHKVNLFDVPLHYNLFQASQEG
KNYDLQNILKNTLVEHHCDLAVTFVDNHDSQSGSSLESQIEDWFKPLAYGLILLMKDGYP
CLFYGDYYGVKGENSPHTQIINILLDTRRKYAYGDQIEYFDHPSAIGFIRTGDEEHVGSG
LVFLMSNDEAGSKKMDLGEEHKGEIWHEITGNIQQEITLDEKGSGEFSVNTRNIAVWIKK
N
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatggtgtaatgatgcagtattttgaatggaatctgccaaatgacggaaattta
tggaaacaattaaaagaagatgcgtcacatttacatgagattggtgtgacagcagtatgg
attccccccgcttacaaagccgacgaacaacaagacgaaggttatgcaacctacgatttg
tatgatctcggcgagttcgatcaaaaaggaaccgtaagaacgaaatatggtacgaaagaa
gaactgaaagaaatgatcgatgaattacataaaaatcatatttccgtttatctggatgta
gtactgaatcataaggcaggaggtgatttcactgaaaagttcatagttgtagaagtcgat
cccaatgatagaacccaagcattaggaaaaccgttcgaaatacagggctggaccggatac
agcttccatggacgtaaggataaatattcagacttcaaatggcattggtatcatttttca
ggaaccggttttaacgatgccaaaaagcggagtggcatcttccagatacagggtgaaggc
aaagcgtggagcgaaggggttgacaatgaaaatggcaactacgatttcttattatgcaat
gatatagacctggatcatcctgaagtagtcaccgaattgaatcgttggggaaaatgggtt
tccaaagagctgaacctcgacggaatgcgtctggatgccatcaaacacatgaaagacaag
ttcattgcacaattcctggatgcggtaagaagcgaaagaggagacaaattctacgctgtt
ggcgaatattggaatggtgatttgaacacactcgatgcatacataaaatccgtgggtcac
aaagtcaacctatttgatgttccattacattataatttattccaagcatcacaagaaggc
aagaattatgatctgcagaatatcctaaaaaacacattagtcgagcaccactgtgatctg
gcagtcacttttgtcgacaatcacgattcgcaatcgggcagttccttggaatcacaaata
gaagactggttcaaaccattggcctatggtctgatattattaatgaaagacggttatcct
tgtttgttctacggagattattatggtgttaaaggagagaactcacctcatacccaaatc
attaatattcttctggataccagaagaaaatatgcttatggcgatcagattgagtatttc
gatcatccttccgccatcggctttattcgtacgggagatgaagaacatgtcggttccggt
ttagtctttttaatgtctaatgatgaagccggcagtaaaaagatggatttgggcgaagaa
cataaaggcgaaatatggcatgaaataaccggaaatattcagcaagaaatcacattagac
gaaaaaggaagtggagaattttctgttaatacccgtaatattgctgtttggataaaaaag
aattaa

DBGET integrated database retrieval system