KEGG   Bacteroides fragilis 638R: BF638R_4059Help
Entry
BF638R_4059       CDS       T01691                                 

Gene name
tuf
Definition
(GenBank) Elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bfg  Bacteroides fragilis 638R
Brite
Translation factors [BR:bfg03012]
 Eukaryotic Type
  Elongation factors
   BF638R_4059 (tuf)
 Prokaryotic Type
   BF638R_4059 (tuf)
Mitochondrial biogenesis [BR:bfg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BF638R_4059 (tuf)
Exosome [BR:bfg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BF638R_4059 (tuf)
  Exosomal proteins of breast cancer cells
   BF638R_4059 (tuf)
  Exosomal proteins of colorectal cancer cells
   BF638R_4059 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: CBW24502
UniProt: E1WPF1
LinkDB All DBs
Position
complement(4776256..4777440)
Genome map
AA seq 394 aa AA seqDB search
MAKEKFERTKPHVNIGTIGHVDHGKTTLTAAITTVLAKKGLSELRSFDSIDNAPEEKERG
ITINTSHVEYETANRHYAHVDCPGHADYVKNMVTGAAQMDGAIIVVAATDGPMPQTREHI
LLARQVNVPKLVVFMNKCDMVEDAEMLELVEMEMRELLSFYDFDGDNTPIIQGSALGALN
GVEKWEDKVMELMEAVDTWIPLPPRDVDKPFLMPVEDVFSITGRGTVATGRIETGVIHVG
DEIEILGLGEDKKSVVTGVEMFRKLLDQGEAGDNVGLLLRGVDKNEIKRGMVLCKPGQIK
PHSKFKAEVYILKKEEGGRHTPFHNKYRPQFYLRTMDCTGEITLPEGTEMVMPGDNVTIT
VELIYPVALNIGLRFAIREGGRTVGAGQITEIID
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagagaaatttgaacgtaccaaaccgcacgtaaacattggtacaatcggtcac
gttgaccacggtaaaaccactttgactgctgctatcactactgtgttggcaaagaaaggt
ctttctgaacttcgttctttcgattctatcgataatgctcctgaagaaaaagaaagaggt
attactatcaatacttcacacgttgagtatgaaactgctaaccgtcactacgcacacgtt
gactgtccgggtcacgctgactacgtaaagaacatggttactggtgctgctcagatggac
ggtgctatcattgtagttgctgctactgatggtccgatgcctcagactcgtgagcacatc
cttttggctcgtcaggtaaacgttccgaagctggttgtattcatgaacaagtgcgatatg
gttgaagatgctgagatgttggagcttgttgaaatggaaatgagagaattgctttcattc
tatgatttcgacggtgacaatactccgatcattcagggttctgctcttggtgcattgaac
ggcgtagaaaaatgggaagacaaagtaatggaactgatggaagctgttgatacttggatt
ccactgcctccgcgcgatgttgataaacctttcttgatgccggtagaagacgtgttctct
atcacaggtcgtggtactgtagctacaggtcgtatcgaaactggtgttatccatgtaggt
gatgaaatcgaaatcctcggtttgggtgaagataagaaatcagttgtaacaggtgttgaa
atgttccgcaaacttctggatcagggtgaagctggtgacaacgtaggtctgttgcttcgt
ggtgttgacaagaacgaaatcaaacgtggtatggttctttgtaaaccgggtcagattaaa
cctcactctaaattcaaagcagaggtttatatcctgaagaaagaagaaggtggtcgtcac
actccattccataacaaatatcgtcctcagttctatctgcgtactatggactgtacaggt
gaaatcactcttccggaaggaactgaaatggtaatgccgggtgataacgtaactatcact
gtagagttgatctatccggttgcactgaacatcggtcttcgtttcgctatccgcgaaggt
ggacgtacagtaggtgctggtcagattactgaaattatcgactaa

DBGET integrated database retrieval system