KEGG   Butyrivibrio fibrisolvens: CIY_08710Help
Entry
CIY_08710         CDS       T02581                                 

Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bfi  Butyrivibrio fibrisolvens
Brite
KEGG Orthology (KO) [BR:bfi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bfi01001]
    CIY_08710
Enzymes [BR:bfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CIY_08710
Protein kinases [BR:bfi01001]
 Serine/threonine kinases: Other
  Bacterial family
   CIY_08710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA CD99L2 Kdo APH Kinase-like Kri1 Haspin_kinase Claudin_2 Pkinase_fungal FTA2 DUF3077
Motif
Other DBs
NCBI-ProteinID: CBK73743
UniProt: D4J0V4
LinkDB All DBs
Position
798630..800495
Genome map
AA seq 621 aa AA seqDB search
MITQGMFIADRYEIIDKVGSGGMSDVYRAKDHILGREVAIKILKQEFSEDATFVAKFRTE
AQSAAGLEHPNIVNIYDVGSENGMYFIVMEYVEGITLKTYIEKKGQLNFKEAISIAIQVG
RGIEAAHQKGIIHRDIKPQNIIISTEGKVKVTDFGIARAASSNTIHADVMGSVHYSSPEQ
ARNGFVDGKSDIYSLGIVMYEMVTGRVPFDGDNTVAIAIQHLQEEMVAPSAYAPDLPISL
EKIILKATMKKADRRYATISDLLMDLKKALVSPNDDFVTIVEPDLGHTRVMHKVTPEQEE
NLTKRAAEVLIEDDYDDEYYDDEYYDDEYYDDDYDDEDEEEDSKMDKVLTIAGVVAAFAI
VAIVVAILGNISGLFSFGSKKVTMINVVGTQYEEALQQLEELGLTEKNVVVSYEDGDEVE
DGIVTQQSVPADKEFSLNDTLRLTVEGSDGSGSSDKSESKESKSEKSGSEGTVSVPSVVG
LSQAEATQTLSNAQIVVTSTTQEFSDEVPSGSVISQSIEAGEMVSPNSSITLVISKGKEE
VTYSYSISNPYDGECTYEIAELGKSGTIPKNGAINISEVKVDTLTVTLTYTPLYLSGDGT
MKPNPNATETSTQAVKGKPNN
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgattacacaaggcatgtttatagcagatagatatgaaataatagataaggttggttca
ggcggaatgtctgacgtttatcgcgcaaaggatcacatccttggccgagaggtcgctatc
aaaatcttaaagcaggagttttctgaggacgcaacatttgttgcaaaatttagaacagag
gctcagtcagctgcaggcttagagcatccaaacattgttaatatttacgacgtaggttca
gagaatggtatgtatttcatcgttatggaatacgtagaaggcattactcttaagacatat
attgaaaagaagggccagctgaatttcaaagaggctatctctattgcaattcaggtaggt
cgtggtatcgaggctgctcaccagaagggcatcattcaccgagatatcaagccacagaat
attatcatttctactgaaggaaaggttaaggttacagactttggtattgcaagggctgcc
agctctaatacaatccacgctgatgtaatgggttctgtacattattcttcaccagagcag
gctagaaatggttttgttgatggaaagagcgatatctattcacttggtatcgttatgtac
gaaatggttacaggccgtgttcctttcgatggggataatactgtagctattgctatccag
catcttcaggaggagatggttgcacctagcgcttacgctccagatcttcctatttcatta
gagaaaattatccttaaggcaacaatgaaaaaggcagacagacgttatgccactatttca
gatttacttatggatttaaagaaggcacttgttagccctaatgacgattttgttactatt
gtagaacctgatttgggacatactcgtgttatgcacaaggttactccagagcaggaggag
aatcttacaaagagagccgcagaggttctcattgaggatgattacgacgacgagtactat
gatgatgagtactacgacgatgaatattatgatgacgactacgatgatgaggacgaggaa
gaagattccaagatggacaaggttcttacaatcgcaggcgttgtagctgcttttgcaatc
gttgcaattgttgtagcaatccttggaaatatttcaggattgtttagctttggttcaaag
aaggtcacaatgattaatgttgttggaactcagtatgaagaggcacttcagcagcttgag
gagcttggccttacagaaaagaatgttgtagtttcttatgaagatggtgacgaagtagag
gatggaattgttactcagcagtctgttccagctgacaaggaattctcacttaatgataca
cttcgtcttacagtagagggttctgatggttctggtagctcagataaatctgaatctaag
gaatctaaatcagaaaagtcaggttcagagggcacagtttctgttcctagcgtagtaggt
ctttcacaggcagaggctactcagactctcagcaacgcacagattgttgttacaagtaca
actcaggaattctctgatgaagttccatcaggttctgttataagccagtctattgaggca
ggcgagatggtttctccaaactctagcattacacttgtaatcagcaagggcaaggaagag
gttacttacagctatagtatttcaaatccatacgatggtgagtgtacatacgaaattgcc
gagcttggcaagtcaggtacaattccaaagaatggagcaatcaatatttcagaggtaaag
gtagatacacttacagttactcttacctacactcctctatatctttcaggtgatggtaca
atgaagcctaatccaaatgcgacagagacttctactcaggctgtgaagggaaaaccaaac
aattaa

DBGET integrated database retrieval system