KEGG   Candidatus Blochmannia floridanus (Camponotus floridanus): Bfl426Help
Entry
Bfl426            CDS       T00138                                 

Gene name
trpE
Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
bfl  Candidatus Blochmannia floridanus (Camponotus floridanus)
Pathway
bfl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bfl01100  Metabolic pathways
bfl01110  Biosynthesis of secondary metabolites
bfl01130  Biosynthesis of antibiotics
bfl01230  Biosynthesis of amino acids
bfl02024  Quorum sensing
Module
bfl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bfl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bfl426 (trpE)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    Bfl426 (trpE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bfl426 (trpE)
Enzymes [BR:bfl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     Bfl426 (trpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: CAD83488
UniProt: Q7VR04
LinkDB All DBs
Position
465508..467073
Genome map
AA seq 521 aa AA seqDB search
MKYQITHAENFRIPVLYHSNPTIVFNQLCRNRYSTLLLESAEIQNKSNIESMMIIDSALR
ITAYNTNVIIHTLTRNGINLLPLLQKTLPSIVKIKKIHAGMQLTFPMIQDKTDEDTRLKS
ISILDCLRSLLKIIKTPKDNPKSIFLGGLFSYDLISCFEPVPKFTNDIICPDYCFYLSEI
LLIFDHQKKLAELHGTLFIPDITEKNRLQSRMHELKKQINHQTHNTIPHKPIQNIQLNCN
QDDESYKKTIRKIQHAIQRGEILQAVPSRCFFLPCPSPLAAYHELKTNNPSPYMFFMQDE
IFTLFGASPESSLKYDAKTRKIEIHPIAGTRARAYYNDGSLDMDTDNKIELEMRLNHKEL
SEHLMLVDLARNDLARVCTAGSRYVADLLKVDRYSYVMHLVSKVIGKLDPSLDALHAYRA
CMNMGTLTGAPKIKAMQIIHKVESRRRNTYGGAIGYLTGLGNLDTCIIIRSAYVINGIAT
VQAGAGIVIDSEPQSEADESRNKARAVLRSIAIAHNCKEIF
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatcaaatcacacatgcagaaaactttagaattccagtactatatcattccaat
ccaaccatagtttttaatcagttatgtagaaatcgttattcaacattattattagaatcc
gcagaaatccaaaacaaaagcaatatagaaagtatgatgattattgatagtgcattaaga
atcacagcttataatacaaatgtcataattcataccctgactagaaacggaattaattta
ctaccactattacaaaaaacactacctagtattgttaaaataaaaaaaatacatgctgga
atgcaattaacatttccaatgatacaagataaaaccgatgaagatacacgtcttaaatca
atctctattttagattgtttacgatcattactaaaaatcataaaaacgcctaaagataat
cctaaatctatattcttaggaggattattttcttatgatttaatatcatgttttgaacct
gtaccaaaatttaccaatgatattatatgtccagactattgcttttacttatctgaaata
ttattaatttttgatcatcaaaaaaaacttgcagaattacatggcacattatttattcct
gatattacagaaaaaaatagattacaaagtagaatgcatgaattaaaaaaacaaattaat
catcaaacccataatactattccacataaacctatacagaatatacaattaaattgtaat
caagatgatgaatcttataaaaaaactatccgtaaaatacaacacgccatacaaagagga
gaaatattacaagccgtaccatcaagatgttttttcctaccatgtccttctccgttagca
gcatatcatgaattaaaaactaataatcctagtccttacatgtttttcatgcaagatgaa
atattcactttatttggagcatctccagaaagctcattgaaatatgatgctaaaactaga
aaaattgaaattcatcccatagccggcactagagcacgcgcatactataatgatggctca
ttagatatggatacagacaacaaaatagaattagaaatgcgtttaaatcataaagaatta
tcagaacatttaatgttagtagatttagccagaaatgatttagctcgagtttgtacagcc
ggtagtcgctacgtagctgacttattaaaagtagaccgttattcttatgttatgcattta
gtctctaaagtgataggaaaattagatcctagtcttgatgctttacatgcttatcgagct
tgtatgaacatgggcacattaacaggagcaccaaaaattaaggctatgcaaataatccat
aaagtggaaagtagacgtcgaaatacttacggtggagcaattggatatttaacaggatta
ggtaatttagatacatgtatcataattagatcagcttatgttataaatggaatagctact
gtacaagcaggagctggcattgtaatagattctgaaccccaatctgaagctgacgaaagt
agaaataaagcacgagccgtgttacgctccattgctatagctcataattgtaaggaaatt
ttctaa

DBGET integrated database retrieval system