KEGG   Candidatus Blochmannia floridanus (Camponotus floridanus): Bfl602Help
Entry
Bfl602            CDS       T00138                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bfl  Candidatus Blochmannia floridanus (Camponotus floridanus)
Pathway
bfl00010  Glycolysis / Gluconeogenesis
bfl00030  Pentose phosphate pathway
bfl00051  Fructose and mannose metabolism
bfl00052  Galactose metabolism
bfl00680  Methane metabolism
bfl01100  Metabolic pathways
bfl01110  Biosynthesis of secondary metabolites
bfl01120  Microbial metabolism in diverse environments
bfl01130  Biosynthesis of antibiotics
bfl01200  Carbon metabolism
bfl01230  Biosynthesis of amino acids
bfl03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bfl602 (pfkA)
   00030 Pentose phosphate pathway
    Bfl602 (pfkA)
   00051 Fructose and mannose metabolism
    Bfl602 (pfkA)
   00052 Galactose metabolism
    Bfl602 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    Bfl602 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Bfl602 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:bfl01009]
    Bfl602 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bfl03019]
    Bfl602 (pfkA)
Enzymes [BR:bfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Bfl602 (pfkA)
Protein phosphatases and associated proteins [BR:bfl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Bfl602 (pfkA)
Messenger RNA biogenesis [BR:bfl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Bfl602 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: CAD83277
UniProt: Q7VRK9
LinkDB All DBs
Position
complement(670114..671076)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDSPGMNAAIRGVVRAGLSEGIEVYGIYDGYLGLFQNRMMLLSYCSVSD
IINKGGTVLGSSRFPELKKDMIRSVVMNNISKSHLDALVIIGGDGSYIGARRLSDLGCPC
IGIPGTIDNDVAGTDYTIGYFTALETIIEAIDRLRDTSSSHQRISIVEVMGRYCGDLTIS
AAIAGGCEFVIIPELKFQMQDLVDKIKLNISKGKKHAIVAITERICNVFDLAQYIENETG
KETRATVLGHIQRGGKPVAYDRILASRMGAYSIELLLKGYGRHCIGIENEKLVHHDINDA
TKYMRRSFRQDLLTTAKKLC
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgataaagaaaataggagtgttaacaagtggtggtgattctccaggaatgaatgcggct
attcgaggagtagttcgggctggtttatctgaaggaatagaagtatatggaatatatgat
ggttatttagggttgtttcagaatcgtatgatgttattgagttattgtagtgtgtcagat
ataattaataaaggtggaacagttttaggatcttctcgttttcctgaattaaaaaaagat
atgattagatctgtagtaatgaataatataagtaagagtcatcttgatgctttagtgata
attggaggagatggatcttatataggagcaagacggttaagtgatttgggttgtccttgt
attgggattccgggtacaattgataatgatgtagctggaacagattatactattggttat
tttacagcattggaaactattattgaggcaattgatcgattaagagatacttcttcatct
catcaacgtatttctattgtagaggtaatgggtcgttattgtggtgatttaactatatct
gccgctatagcaggtggttgtgagtttgttattattccagaattaaagtttcaaatgcaa
gatttagtagataaaattaagttaaatatttctaaaggaaaaaaacatgctatagttgct
ataactgagcgtatttgtaatgtttttgatttagctcagtatattgaaaatgaaactgga
aaagaaacccgggctactgttttaggtcatattcaacgtgggggaaagccagttgcatat
gataggattttggcatctagaatgggggcgtattctattgagttgttgttaaaaggttat
ggtagacattgtattggtatagaaaatgaaaagttagttcatcatgatattaatgatgct
acaaagtatatgcgtcgttcatttcggcaagatctattaacaacggctaaaaagttgtgt
taa

DBGET integrated database retrieval system