KEGG   Brevibacillus formosus: BP422_01770Help
Entry
BP422_01770       CDS       T04939                                 

Definition
(GenBank) peptidase M4 family protein
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
bfm  Brevibacillus formosus
Brite
KEGG Orthology (KO) [BR:bfm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bfm01002]
    BP422_01770
Enzymes [BR:bfm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     BP422_01770
Peptidases [BR:bfm01002]
 Metallo Peptidases
  Family M4: thermolysin family
   BP422_01770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY Me-amine-dh_H DUF4157
Motif
Other DBs
NCBI-ProteinID: ASJ52378
UniProt: A0A220MBJ7
LinkDB All DBs
Position
323859..325445
Genome map
AA seq 528 aa AA seqDB search
MKKSVFAVTLSFALGTTTFLPLATQAASESIVYSAEWDTPEFIGEEFEAEDLDGEEKVWG
FLEQYQDSFRIDGDVRDHFKVLDEMKDRETDMTHYRVQEMYEGIPVYGYQQTIHVNEDGN
VTAFLGNYAPDLSDNDKLTKKPKLKSDKAVKEAIKDLEDEIDGKVEKFEVKPKGNLYIYI
HEDESYLAYEVELNFLDPQPGRWKYFIDANTGDVINKYNMLHEITGTGTGVLGDSKSFEV
TKVSNTNYTAKDTTRGKGIETYTARNRTSLPGTLGSDTDNNWTDGALVDAHAYAQATYDY
YKNEHNRNSFDNNGAKIISTVHYSNRYNNAFWNGVQMVYGDGDGSVFRPLSAGLDVVAHE
LTHAVTERTADLIYQNESGALNESISDIFGAMIDNDDWLLGEDVYTPGTPGDALRSLEDP
TIAGDPDHYSDRYTGPNDNGGVHTNSGINNKAAYLLAEGGSHHGVTVTGIGRNDTAKIYY
YALTNYLNPNSNFSAMRQAAIQSATVLFGANSQQVESVRDAYDAVGVQ
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatcggtttttgcagtaacactcagcttcgctttaggtaccactacattcctg
ccgttggctacgcaggccgcatccgaaagcatcgtgtatagcgctgagtgggataccccc
gaatttatcggagaagagttcgaagcagaagatctggatggcgaagaaaaagtttgggga
ttcctggaacagtatcaagattctttccgcattgatggagatgtgagagatcactttaaa
gtgcttgatgaaatgaaagacagagagacagacatgactcactaccgtgtacaagaaatg
tacgagggcatcccggtctatggttaccagcagacgattcacgtaaacgaggatgggaat
gtaacggctttcctcggaaactacgcgcctgacctgtcagacaatgataagctgacgaaa
aaaccaaaactaaagtcagacaaagcggtcaaagaggccatcaaggatttggaagatgag
attgacggaaaagtggagaagttcgaggtgaagccaaaagggaacctctatatctacatc
cacgaagatgaatcgtatctggcttacgaagtggagctgaatttcctcgatccgcagcca
gggcgttggaagtatttcatcgatgcaaacactggtgacgtgattaacaaatacaatatg
ctgcatgaaattacaggaacgggtacgggggtacttggtgactctaagtccttcgaagta
acgaaagtaagcaatacaaactacacggcgaaagatacaactcgcggcaagggaattgaa
acgtacactgcacgcaatagaaccagcctgccaggtactcttggttccgacacggataac
aattggacagatggagcgcttgtcgacgcacatgcctatgcacaggcaacctacgattac
tacaaaaacgagcataaccgcaatagctttgacaacaatggtgcgaaaatcatctccaca
gtccactacagcaacagatacaacaacgcattctggaacggtgtgcaaatggtgtacggg
gatggagatggaagcgtattccgcccattgtccgctggattggatgtcgttgctcatgaa
ttaactcacgctgtcacagaacgaacagccgatctgatctatcaaaacgaatccggtgca
ttaaatgaatccatctctgatatcttcggggcaatgattgacaacgacgattggctattg
ggtgaagatgtatacacgccaggaacgcctggagatgcactgcgctctctcgaagatcca
actattgctggtgatcctgatcactacagcgatcgatacacaggtccaaatgacaatgga
ggcgtacacactaacagcggtatcaacaacaaagcggcctatctcctcgcagagggtggc
tcacaccacggtgtaacggttacaggcattggtcgcaatgacacagcaaaaatctactac
tacgctctaacaaactacctcaatccaaactctaatttctccgctatgcgacaagcagct
attcaatccgcaacagttcttttcggtgctaattcccaacaagtagaatctgtaagagat
gcgtatgatgcagttggtgtgcaataa

DBGET integrated database retrieval system