KEGG   Brevibacillus formosus: BP422_02050Help
Entry
BP422_02050       CDS       T04939                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bfm  Brevibacillus formosus
Pathway
bfm00010  Glycolysis / Gluconeogenesis
bfm00030  Pentose phosphate pathway
bfm00051  Fructose and mannose metabolism
bfm00052  Galactose metabolism
bfm00680  Methane metabolism
bfm01100  Metabolic pathways
bfm01110  Biosynthesis of secondary metabolites
bfm01120  Microbial metabolism in diverse environments
bfm01130  Biosynthesis of antibiotics
bfm01200  Carbon metabolism
bfm01230  Biosynthesis of amino acids
bfm03018  RNA degradation
Module
bfm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bfm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP422_02050
   00030 Pentose phosphate pathway
    BP422_02050
   00051 Fructose and mannose metabolism
    BP422_02050
   00052 Galactose metabolism
    BP422_02050
  Energy metabolism
   00680 Methane metabolism
    BP422_02050
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BP422_02050
Enzymes [BR:bfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BP422_02050
Protein phosphatases and associated proteins [BR:bfm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BP422_02050
Messenger RNA biogenesis [BR:bfm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BP422_02050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1 DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ASJ52429
UniProt: A0A220MC36
LinkDB All DBs
Position
386281..387240
Genome map
AA seq 319 aa AA seqDB search
MRKLAVLTSGGDSPGMNAAVRAAVRRAHFHEVQMFGVYHGYEGLMRGDIKEMSLGSVGDI
IQRGGTILYSARSEAFKTEAGQQRAVEQLLAHEIEGLIVIGGDGSFRGAQKLTEKGFPTI
GVPGTIDNDIPCTDFTIGFDTALNTIVDAIDKIRDTATSHERTYIIEVMGRDAGDLALWA
GLAAGAESIIIPEASQEMDDIIERLHAGQRRGKKHSIIIVAEGVGSATSYAEAITKETGW
ETRVTVLGHIQRGGSPTAMDRMLASRMGAAAVDLLLEGKQDRMVGIQNNQIVDVDFQEAL
AKKHQLDLSIYQLARTLSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaacttgcagttctcactagcggtggagattctcctggaatgaatgccgcagtc
cgggcggctgtacgtcgtgctcattttcacgaggtacaaatgtttggggtttaccacggg
tacgaagggctgatgaggggagatatcaaggagatgtctctgggctctgttggggatatt
atccaacggggaggaaccattctctactccgctcgcagtgaagcgttcaagacggaagcc
ggacagcaaagagcggtggaacaattacttgctcatgaaattgagggtctgattgtgatt
gggggagacgggtcgtttcgcggtgcacagaagttgaccgaaaaaggcttcccgactatt
ggcgtaccgggtacgattgataatgacattccatgcaccgatttcacgatcgggtttgat
accgcattgaataccattgtggatgcaatcgataaaatccgcgatacggccacctcgcat
gaacgtacgtacattattgaagtaatggggcgagatgctggagacctggcattgtgggca
gggcttgcagctggtgccgagtccattatcatcccggaagcgtcgcaggagatggacgac
attattgagcgtctgcatgctggacaacgccgtggcaaaaagcattccatcatcattgtg
gcggaaggggtaggaagtgcgacttcatacgccgaagcgatcacgaaagagacaggctgg
gagactcgcgtgacggtactgggtcacattcagcgtggtggttcccctactgcgatggat
cgaatgctggcgagccgaatgggtgcggcagctgtcgatttgttgctggaaggcaagcag
gaccgaatggttgggattcagaacaaccagatcgttgatgttgattttcaagaagcattg
gcgaaaaagcatcaattggatttatccatttatcaattggcgcgcacgctatctatataa

DBGET integrated database retrieval system