KEGG   Brevibacillus formosus: BP422_02085Help
Entry
BP422_02085       CDS       T04939                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bfm  Brevibacillus formosus
Pathway
bfm00020  Citrate cycle (TCA cycle)
bfm00480  Glutathione metabolism
bfm01100  Metabolic pathways
bfm01110  Biosynthesis of secondary metabolites
bfm01120  Microbial metabolism in diverse environments
bfm01130  Biosynthesis of antibiotics
bfm01200  Carbon metabolism
bfm01210  2-Oxocarboxylic acid metabolism
bfm01230  Biosynthesis of amino acids
Module
bfm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bfm_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bfm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BP422_02085
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BP422_02085
Enzymes [BR:bfm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BP422_02085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ASJ52436
UniProt: A0A220MBQ6
LinkDB All DBs
Position
396079..397362
Genome map
AA seq 427 aa AA seqDB search
MFKNLTQPTVGEKITVDNGKLVVPNNPIIPFIEGDGTGPDIWKASVRVLDAAVEKAYKGE
KKIAWFEVFAGEKSFNQYSEWLPEDTLTAVREYLIAIKGPLTTPVGGGIRSINVALRQEL
DLYACVRPVQYFDGVPSPVKHPELTDMVIFRENTEDIYAGVEWAEGTPEVKKVIDFLQNE
MGVKKIRFPETSGIGIKPVSKDGTERLVRAAIDYAIENNRKSVTLVHKGNIMKFTEGAFK
TWGYAVAEAEFGDKVFTWAQYDRIKAEGGDADKAQKEAEAAGKIIVKDVIADAFLQQILT
RPAEYDVVATLNLNGDYVSDALAAQVGGIGIAPGANINYLTGHAIFEATHGTAPKYAGLD
KVNPSSVILSGEMMLRHLGWNEAADLIINSMEKTISAKTVTYDFARLMEGAQELKCSEFA
DALIQNM
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgtttaaaaacctgacgcaaccaactgtaggcgaaaaaattactgtggataacggtaaa
ctggtagttccaaacaatccgatcattcctttcatcgaaggtgacggtactggccctgac
atttggaaagcttccgttcgcgttctggatgcagctgtagaaaaagcttacaaaggcgag
aagaagatcgcttggttcgaagtattcgcaggtgaaaaatccttcaaccagtacagcgag
tggctgccagaagatacgctgactgctgttcgtgaatacctgatcgcaatcaaaggtcct
ctgacaacaccagtaggcggcggtatccgttctatcaacgtagcactgcgtcaagagctg
gatctgtatgcttgcgtacgtcctgttcaatatttcgatggtgttccatccccagtgaaa
catcctgaattgacagacatggtaatcttccgcgagaacactgaagacatctacgctggt
gtagagtgggctgaaggtactccagaagtgaaaaaagtaatcgacttcctgcaaaacgaa
atgggcgtgaagaaaatccgcttcccagaaacttctggtatcggtatcaagcctgtttcc
aaagatggtacagagcgtctggttcgtgcagcgatcgactatgcgatcgagaacaaccgc
aaatccgttaccctcgtacacaaaggtaacatcatgaagttcacggaaggtgcgttcaaa
acttggggatatgcagtagctgaagcagaattcggcgacaaagtattcacttgggcacaa
tacgatcgtatcaaagctgaaggcggcgacgctgacaaagcacaaaaagaagcagaagca
gctggcaaaatcatcgtgaaagatgtaattgctgacgcgttcctgcaacaaatcctgact
cgtccagctgagtacgatgtagtagcaacactcaacctgaacggtgactatgtatctgac
gcactggctgcacaagtaggcggtatcggtatcgctccaggtgcaaacatcaactacctg
actggccatgcgatcttcgaagcaactcatggtacagctccgaaatacgctggtctggac
aaagtaaacccatcctccgtgatcctgtccggagaaatgatgctgcgtcacctgggttgg
aacgaagcagctgatctgatcatcaactccatggaaaaaaccatctccgcgaaaacagta
acatacgatttcgctcgtctgatggaaggcgcacaagaactgaaatgctccgagtttgct
gacgctctgattcaaaacatgtaa

DBGET integrated database retrieval system