KEGG   Brevibacillus formosus: BP422_02670Help
Entry
BP422_02670       CDS       T04939                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bfm  Brevibacillus formosus
Brite
KEGG Orthology (KO) [BR:bfm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BP422_02670
Enzymes [BR:bfm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BP422_02670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored DAO Thi4 FAD_binding_3 HI0933_like AlaDh_PNT_C K_oxygenase NAD_binding_8 Glutaredoxin Thioredoxin_4 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ASJ52545
UniProt: A0A220MC05
LinkDB All DBs
Position
complement(524469..525998)
Genome map
AA seq 509 aa AA seqDB search
MALDQEIKAQLEQYLELLEGDIVLKVSAGTDEASSEMLALIDELASMSLKISVEKAELTR
TPSFSVNRVGEDTGVVFAGTPLGHEFTSLVLALLQVSGRAPKVEQSVIDQIKDLRGEYKF
ESYISLSCHNCPDVVQALNLMSIFNPGVTHTMIDGAVFKDEVESKNVMAVPSVFLNGEFF
ESGRMTVEEILAKLGSAPDASEFDNKDPYDVLVVGGGPAGASAAIYAARKGIRTGLVAER
LGGQVNDTLGIENFISVKYIEGPQLAANLEKQVKEYGIDVMKLQRAKRLEKKDLIEVELE
NGAVLKSKTVILSTGARWRNLGVPGEAEFKNKGVAYCPHCDGPLFIGKDVAVVGGGNSGV
EAAIDLAGIVKHVTVLEFSPELKADAVLQDRLYSLPNVTVLKNVQTKEITGTDKVNGISY
IERETGETKHIELQGVFVQIGLVPNTDWLGDTIERTRFGEIVVDSHGSTNIPGVFAAGDC
TNSAYKQIIISMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggcccttgaccaagaaatcaaagcgcaactagaacaatatctcgagctcttggaaggc
gatattgtactcaaagtcagtgcaggcacggatgaggcatcctctgagatgcttgcactg
attgatgagctagcaagcatgtctttgaagatcagtgtggagaaagcagaactcactcgc
acacctagctttagcgtaaaccgtgtcggcgaagatactggcgttgtttttgccggtact
ccgctgggtcacgaatttacttccttggtattggctctcttgcaagttagcggaagagct
ccaaaggtcgagcaaagtgtcattgatcaaatcaaagaccttcgtggtgaatataagttc
gaatcttacatcagcttgagttgccacaattgtccagatgttgtccaagctctgaacttg
atgagtatcttcaatcctggtgttactcatacaatgattgacggtgccgtattcaaggac
gaggtagagagcaaaaacgtgatggctgtgccaagcgttttcctcaatggtgaatttttc
gaaagcggccgtatgacagtggaagaaattcttgccaagctgggttctgctccggacgca
tccgagtttgacaataaagacccttatgacgtgcttgttgtgggcggtggaccagcaggt
gctagtgcggcgatttatgcagcacgcaaagggattcgtaccggtctcgttgctgaacgc
cttggcggtcaagtcaatgacacattgggcattgagaacttcatcagtgtgaaatacatt
gaaggtcctcagctcgcagccaacttggaaaagcaagtgaaagagtatggcattgatgtc
atgaagctgcaacgtgccaagcgtttagagaagaaggatctgatcgaagttgaactcgaa
aatggcgctgttctgaagagtaagacagtcatcttgtcgacaggtgctcgttggcggaat
ctgggtgtacctggtgaagcagagttcaagaacaagggtgtagcttattgccctcactgc
gatggtcctttgttcataggcaaagatgtcgcagttgttggcggcggtaattcaggtgtg
gaagcagcgattgatctcgcaggtattgtgaaacatgtaaccgttctggaattctcgcca
gaactgaaagctgacgcagtattgcaagatcgtctttacagtctgccaaatgtcactgta
ctcaaaaacgttcaaaccaaagaaatcacgggtacggataaagtaaacggcatttcttac
atcgaacgtgagacaggcgaaaccaagcacattgaattgcaaggtgtgtttgtacagatc
ggtctggtaccgaatacagattggttgggcgacacgattgagcgcactcgctttggtgag
atcgtagtagacagccatggttctacaaacatccctggtgtttttgcagccggtgattgc
acgaacagtgcttataaacagatcatcatttcgatgggatctggtgctactgcggctttg
ggagctttcgattatctcatccgcaattaa

DBGET integrated database retrieval system