KEGG   Brevibacillus formosus: BP422_05335Help
Entry
BP422_05335       CDS       T04939                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bfm  Brevibacillus formosus
Pathway
bfm00473  D-Alanine metabolism
bfm00550  Peptidoglycan biosynthesis
bfm01100  Metabolic pathways
bfm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bfm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BP422_05335
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BP422_05335
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BP422_05335
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bfm01011]
    BP422_05335
Enzymes [BR:bfm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BP422_05335
Peptidoglycan biosynthesis and degradation proteins [BR:bfm01011]
 Precursor biosynthesis
  Amino acid ligase
   BP422_05335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 RimK ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ASJ57444
UniProt: A0A220MQH9
LinkDB All DBs
Position
1101547..1102674
Genome map
AA seq 375 aa AA seqDB search
MGNQKIRLGIIYGGKSSEHEVSLRTAMSIMQAVDANKYEVTPVYVQLDGSWVTGETLAGQ
LPDKIEALRLSEKTPAITEGTETGQELAVTSKSGSLFAMNEQMDVVFPVVHGPFGEDGTI
QGLLELANIPYVGTGVMASAVGMDKWMMKTVFAQAGLPQVKYVGLLRSQWEKGQDDVMDR
IERELGYPCFVKPANMGSSVGINKAKNREELKHALEVAAKFDRRLIVEEFVQARELEIGV
LGNEELMTSVVGEVIAAKEFYDYEAKYKGAGTELSIPAIVPEHVSEQIAEIAMQAFQALD
GSGLSRVDFFWDEKNDKLYINEVNTMPGFTPFSMYPMLFQAAGVSYSELIDRLVQLAIER
HADKGRNVVDAEELD
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcaaaagattcgacttggcattatttatggaggaaaatcctcagagcatgaa
gtttcattgcgtacggccatgtccattatgcaggctgtagatgcaaataaatatgaggta
acacctgtgtacgttcaattggatggctcttgggtgactggagaaacactggcaggtcaa
ctgccggataagatcgaagcgttgcgcttatcggaaaaaacaccagctattaccgaggga
acagagacagggcaagagctggcagtaacaagcaagtcagggtcgctgtttgccatgaat
gagcaaatggatgttgttttccctgtggttcacggaccatttggcgaagatgggacgatc
cagggactgttggaattggcgaatatcccgtacgtgggaaccggagtaatggcttccgct
gtcggaatggataaatggatgatgaagaccgtctttgcacaggctggacttccgcaagtg
aaatatgtaggcttgctgcgctcgcaatgggaaaaaggccaggacgatgtcatggatcgg
atcgagcgtgaactcggctatccgtgtttcgtcaaaccggcgaatatgggctccagtgta
gggattaacaaagcgaaaaatcgtgaggagctcaagcacgcattagaggtagctgccaag
tttgaccgcagattgattgtggaagagttcgttcaagcacgtgaattggagattggcgtt
ttggggaatgaagagctgatgacatccgtcgttggggaagtcattgccgctaaagaattt
tacgattacgaagccaaatacaagggggcgggaacagagctctccattcctgccatcgtt
cccgagcatgtatccgaacaaattgcggaaatagccatgcaggcattccaagcactcgat
ggctctggcctttcccgtgtagactttttctgggatgagaaaaacgacaagctctatatc
aacgaagtgaatacgatgccaggctttacgccgtttagcatgtatccaatgctcttccaa
gcagcgggtgtgagctacagcgagctgatcgatcgtctggtgcaactcgctatcgagcga
catgcggataaaggtcgcaacgtcgtagatgcggaagagttggattaa

DBGET integrated database retrieval system