KEGG   Brevibacillus formosus: BP422_20775Help
Entry
BP422_20775       CDS       T04939                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bfm  Brevibacillus formosus
Pathway
bfm00071  Fatty acid degradation
bfm00280  Valine, leucine and isoleucine degradation
bfm00281  Geraniol degradation
bfm00310  Lysine degradation
bfm00360  Phenylalanine metabolism
bfm00362  Benzoate degradation
bfm00380  Tryptophan metabolism
bfm00410  beta-Alanine metabolism
bfm00627  Aminobenzoate degradation
bfm00640  Propanoate metabolism
bfm00650  Butanoate metabolism
bfm00903  Limonene and pinene degradation
bfm01100  Metabolic pathways
bfm01110  Biosynthesis of secondary metabolites
bfm01120  Microbial metabolism in diverse environments
bfm01130  Biosynthesis of antibiotics
bfm01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bfm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BP422_20775
   00650 Butanoate metabolism
    BP422_20775
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BP422_20775
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BP422_20775
   00310 Lysine degradation
    BP422_20775
   00360 Phenylalanine metabolism
    BP422_20775
   00380 Tryptophan metabolism
    BP422_20775
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BP422_20775
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BP422_20775
   00281 Geraniol degradation
    BP422_20775
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BP422_20775
   00627 Aminobenzoate degradation
    BP422_20775
   00930 Caprolactam degradation
    BP422_20775
Enzymes [BR:bfm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BP422_20775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ASJ55773
UniProt: A0A220MLF2
LinkDB All DBs
Position
complement(4501366..4502139)
Genome map
AA seq 257 aa AA seqDB search
MAYEYISVASEDGVGIITLNRPKILNALNLQLVDELVDQLEKMDRDPDIRVIILTGNARA
FAAGADINEMAEASAIDIMKRNQFAVWDRILLISKPIIGAVSGFVLGGGCELMMNCDIVI
ASETAVIGQPEIKLGVMPGAGGTQRLTRVVGERKALEMLLTGEPISAKEALKYGLVNRVV
PVEAYYQEALKLAKQIAQQPPLAVQVIKKAVYKAGDLPLQEGMDYERNSFYLLLASEDRK
EGMQAFLEKRKPRFTGH
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcctatgaatatattagcgtagccagtgaagatggtgtgggtatcattacgttgaat
cgaccgaagattctaaacgcgctgaatttgcagctcgtcgacgaattggttgaccagctg
gagaaaatggaccgcgacccggatattcgggtgatcatcctgactggaaacgcaagggcg
ttcgcagcgggtgctgacattaatgaaatggcggaagcatcagcgatcgacatcatgaag
cgcaatcagtttgcggtttgggatcgcatcttactcatctccaagccgattattggtgcc
gtcagcggctttgtgctcggtggtggctgtgaattaatgatgaactgcgatattgtgatc
gcttcggagacagccgtcattggtcaaccggaaatcaagctgggagtcatgcctggggct
ggtggtacacagcgtctgacgcgtgtggtaggtgagcgaaaagcactggagatgctgctc
acaggtgaaccgatttcggccaaagaagcgttgaaatacggactggtcaatcgggtagtg
ccagtggaggcgtactatcaggaagcgctcaagctggcaaagcaaatcgctcagcagccg
ccgctcgctgtacaggtcatcaaaaaagccgtgtacaaagctggtgatctccctcttcaa
gagggaatggattacgagcgaaacagcttttatcttcttttggcaagcgaagatcgaaaa
gaaggcatgcaagcgtttctggagaagcgcaaaccccgttttacgggacattag

DBGET integrated database retrieval system