KEGG   Brevibacillus formosus: BP422_22670Help
Entry
BP422_22670       CDS       T04939                                 

Definition
(GenBank) flagellar biosynthesis protein FlgN
Organism
bfm  Brevibacillus formosus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlgN Seryl_tRNA_N
Motif
Other DBs
NCBI-ProteinID: ASJ56101
UniProt: A0A220MM17
LinkDB All DBs
Position
complement(4907955..4908446)
Genome map
AA seq 163 aa AA seqDB search
MNRLYDLLDNLIQLHKALYTLAMHKKDVLVKGDVDELVAITRQEQKLIKGVTEAEAARQQ
VVKELTAQKGFALQEGTLAELIKLTTSAEEKMRLTSSRNELSRIVTELREANDLNQQLLE
QSLSFVNMTLDLITDTPEDDFIYGRPTSDTYRQANRTFFNKKA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaatagactctacgatctgctcgacaacttgatccagttgcacaaagccttgtacacc
ttagctatgcacaagaaagatgtgctggtaaaaggggatgtggatgaattagtagccata
acacgccaggagcaaaaactgatcaagggcgtcacagaagcagaagcagcccgccagcaa
gtcgtaaaagaactgacagcacagaagggctttgcgctgcaagaaggcacactggctgaa
ttgatcaagttgacgaccagtgcggaagagaaaatgcgcctcacttccagtcgtaatgag
ctaagccggattgtgaccgaactgcgcgaggctaacgacctgaatcagcagttactggag
caatccctttcttttgtaaacatgacgctcgacctgataacggatacacctgaggacgac
tttatctacggaagaccaacctcggatacgtatcgtcaggctaatcgaacttttttcaac
aaaaaagcataa

DBGET integrated database retrieval system