KEGG   Brevibacillus formosus: BP422_26230Help
Entry
BP422_26230       CDS       T04939                                 

Definition
(GenBank) Hsp33 family molecular chaperone
  KO
K04083  molecular chaperone Hsp33
Organism
bfm  Brevibacillus formosus
Brite
KEGG Orthology (KO) [BR:bfm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bfm03110]
    BP422_26230
Chaperones and folding catalysts [BR:bfm03110]
 Heat shock proteins
  HSP33
   BP422_26230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33 Elf1 Peptidase_M23 Ribosomal_S9
Motif
Other DBs
NCBI-ProteinID: ASJ56723
UniProt: A0A220MP56
LinkDB All DBs
Position
5646510..5647382
Genome map
AA seq 290 aa AA seqDB search
MGDYMIRATGFNGHVRAFAARTTESVEEMRRRHDMWNTATAAAGRTLTITLMMGAMLKGN
ESLHVKVKGGGPIGQIMAEANAHGEGIAYVSNPHVHFELNDKGKLDVARAVGTDGFVYVT
KDLGLKEPYQGSAPIVSGEIGEDFTYYFVMSEQTPSAVGVGVLVNPEDRSVLAAGGFILQ
LLPNTPEEVVAAIEERLGQLPQVSRMIGEGLTPEEILARVLDEPKILSRTEIQFSCKCTA
DKVVQALISMGREEMEGLIEEQGEAEVHCHFCNERYHYDRSALEDILKDM
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgggcgattatatgataagagcaactggttttaatgggcatgttcgtgcatttgccgcg
cgcacgacagaatctgtcgaagagatgcgtcgtcgtcacgacatgtggaatacagcgaca
gcagcagcgggacgtacgctgacgattaccttgatgatgggggctatgttaaaaggaaac
gagagcctccatgtcaaagtaaaaggaggcggaccaatcgggcagatcatggcggaagca
aacgcacatggtgaaggaatcgcgtatgtttccaacccgcatgtccactttgagctaaac
gataaaggcaagctcgatgtagcacgtgcagtgggaacagacgggtttgtgtacgtaacg
aaagatctcggtctcaaggagccgtatcaaggcagtgcgccgatcgtctctggtgagatt
ggggaagacttcacttattattttgtgatgtccgagcaaacgccttcagcagtaggtgtg
ggtgtactggttaatcctgaagaccgttctgttttggctgcgggtggttttattcttcag
ctgttgccgaatacgcctgaagaggttgtggcagcaatcgaagagcgtttgggacagctt
ccacaggtttctcgcatgattggcgaaggcttgactcctgaagagattttggcgcgcgta
ttggatgagccaaaaatcctgagccgcacggagattcaatttagctgcaaatgtacagcg
gataaggttgttcaggcactgatcagcatgggacgcgaagaaatggaaggtctgattgag
gaacagggcgaagcagaagtacactgtcatttctgtaatgaacgttaccattatgacaga
tccgcgttggaagacatcctgaaagacatgtaa

DBGET integrated database retrieval system