KEGG   Brevibacillus formosus: BP422_28005Help
Entry
BP422_28005       CDS       T04939                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bfm  Brevibacillus formosus
Pathway
bfm00473  D-Alanine metabolism
bfm01100  Metabolic pathways
bfm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bfm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BP422_28005
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BP422_28005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bfm01011]
    BP422_28005
Enzymes [BR:bfm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BP422_28005
Peptidoglycan biosynthesis and degradation proteins [BR:bfm01011]
 Precursor biosynthesis
  Racemase
   BP422_28005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ASJ57026
UniProt: A0A220MPL9
LinkDB All DBs
Position
5995955..5997157
Genome map
AA seq 400 aa AA seqDB search
MKSFCRDTWVEVDLDAIRANLETFKRHLPEKTGIMAVVKADGYGHGAVHVGKEALASGAD
SLAVALLDEATILRRAGITAPILVLGYTPVESIVTASELEVQLTAYSVEWITEANDILQK
NDHKPVGIHVKTDTGMGRLGVRTKEDLLAVVGALEECSKLEWTGIFTHFACADEPDTTHV
RRQHDLFQSFLQVLREANKTLPTVHCCNTAAAIAFPDWGYDTIRLGIGLYGLYPSLYMKE
RADVILAPVLALKTRIAQVKKADEPFTVSYGATYAAQPDEWIATLPIGYADGYSRLLSNR
GEVLYNGSRYPIAGRVCMDQIMVSLNSTEAAVNDEVVLYGKQGDEEISLDEIADLLGTIN
YEVPCMLNYRIPRLYLRDQKVTDVFHPLTMKHSSHENVKN
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgttttgtcgtgacacttgggtagaggttgatttggatgccatccgggcgaac
ctcgagacattcaaacgccatttgccagaaaaaacgggtattatggctgttgtgaaagca
gacgggtatggtcatggcgctgtccatgttggaaaagaagccttggcgagtggtgcagac
tcacttgcagtcgcattgctcgatgaagcgactattttgcggagggcagggattacagcg
ccaattttagtgttgggatacacacctgtcgaatccattgtcaccgcaagcgagctggaa
gtgcagttaaccgcttacagcgtcgaatggatcacggaagcgaacgacattcttcagaaa
aacgatcacaagcctgtcgggattcatgtgaagactgatacgggcatgggacgtttgggc
gttcggacaaaggaagatttgcttgcggttgtaggtgcgcttgaagaatgctctaagcta
gagtggacaggcatttttacgcattttgcctgcgcggatgaaccagatacgacccatgtg
cgacgacaacacgacttgtttcaatcctttttgcaagtactgcgtgaagctaataaaaca
ttgccgaccgttcattgctgcaatacggctgcggctatcgcatttcccgattgggggtat
gatacgattcgtttaggcataggtttatacggattgtatccttctttgtacatgaaagaa
cgcgcggatgtcattcttgcccccgtcttggcgctcaaaaccagaattgcccaagtgaag
aaggcagatgagccattcacggtcagctatggtgctacgtacgcagcacagcctgacgag
tggatcgcaacgctgccgatcggatacgcagatggctattctcgccttttgtccaatcgc
ggtgaggtgttgtacaatggatctcgctacccgattgcaggcagagtttgcatggaccaa
atcatggtcagcctgaattcgacagaagcagcagtcaatgatgaggtcgtcttgtacggc
aagcaaggggacgaggaaatctccttggatgaaattgccgatttgctggggacaatcaat
tacgaggttccttgtatgctgaattaccgaattccgcgcctctatttgcgcgaccagaag
gtaacggacgtatttcacccattgacgatgaagcactcgtcccatgaaaatgtaaaaaac
tag

DBGET integrated database retrieval system