KEGG   Brevibacillus formosus: BP422_29640Help
Entry
BP422_29640       CDS       T04939                                 

Definition
(GenBank) protein-glutamine gamma-glutamyltransferase
  KO
K00686  protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
bfm  Brevibacillus formosus
Brite
KEGG Orthology (KO) [BR:bfm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BP422_29640
Enzymes [BR:bfm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     BP422_29640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ASJ57308
UniProt: A0A220MQI0
LinkDB All DBs
Position
6341415..6342245
Genome map
AA seq 276 aa AA seqDB search
MIVIAGRPANPASLAMEWGLNPVQHETVAIMARSDEVFEYPTPELLQFELKMRDHLVRSA
LALNESGLAFSTFEESRANPAYWIRTDQGGFRLRPGVLPSSGIINIFREGQKYATECATA
MVIIIYHAVLQSIRLPDFERMFADILLYDWRYDQDLDLQTLRTNTFLPGDVIYFANPDYD
RATPQWQGENAVVLGNGLYYGHGVGIKRANEMVAFLNEQRRAGAMRSAYRVNQATRPGFA
YLFPYDNGRSIMRVSGNPLQASSRITAQIGSLSWEW
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgatcgttatagcggggagaccagctaatcccgcatcgttggcaatggaatggggatta
aatccggtacagcatgaaacggtagcgattatggcacgaagtgatgaagtatttgaatat
ccgactcctgagctcctgcaatttgaactgaaaatgcgcgatcatctggtgaggtctgcc
ttggcactgaacgaaagcggcctagccttttctacttttgaagaatctcgtgccaatcca
gcttactggatacgaacagaccagggcggatttcgcttgcgacccggagtgctgccatcc
agcgggattatcaatatttttcgtgagggccaaaaatacgccacggagtgtgctacggcg
atggtcattattatttatcatgcagtcctacaatccattcgtttaccggattttgagaga
atgtttgcggacattttgctatatgactggcgatacgatcaggatctggacttgcaaaca
ttaaggacaaataccttcttgcctggtgatgtgatttattttgccaatcccgattacgat
cgcgcgacaccgcagtggcaaggggaaaatgcagtagtgctcggcaatggcttgtattac
gggcatggtgtggggatcaaacgagcgaatgagatggtagcatttttgaatgaacaacga
agagcgggagcaatgaggtctgcctatcgggtcaatcaggcgactcgtcctggtttcgcc
tacctgtttccctatgacaacggtcgttcaatcatgcgagtttccggcaatcccttacaa
gcgagcagtcgaatcacagcgcagatcggttctttgtcttgggagtggtaa

DBGET integrated database retrieval system