KEGG   Paraburkholderia fungorum: OI25_1410Help
Entry
OI25_1410         CDS       T03799                                 

Gene name
acoD
Definition
(GenBank) acetaldehyde dehydrogenase 2
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bfn  Paraburkholderia fungorum
Pathway
bfn00010  Glycolysis / Gluconeogenesis
bfn00620  Pyruvate metabolism
bfn01100  Metabolic pathways
bfn01110  Biosynthesis of secondary metabolites
bfn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bfn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OI25_1410 (acoD)
   00620 Pyruvate metabolism
    OI25_1410 (acoD)
Enzymes [BR:bfn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     OI25_1410 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA LuxC
Motif
Other DBs
NCBI-ProteinID: AJZ60248
UniProt: A0A0D5VDU6
LinkDB All DBs
Position
1:1599467..1600987
Genome map
AA seq 506 aa AA seqDB search
MNHAEMQFLTTEFPYKKQYANFIGGEWVKPVGGEYFDNISPITGEPFTSIPRSREADIEL
ALDAAHRAKTAWGKTSTTERANILNRIADRMEANLQRIAVAETIDNGKPLRETMAADIPL
AIDHFRYFAGAVRAQEGGISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASILVLLELIHDLLPPGVLNVVNGFGLEAGKPLASNKRIAKIAFTG
ETTTGRLIMQYASQNIIPVTLELGGKSPNIFFADVMNEDDSYFDKALEGFTMFALNQGEV
CTCPSRVLIDEKIYDRFMERALKRVAAITQGHPLDTKTMIGAQASQEQLEKILSYVDLGK
QEGAECLIGGERNTLGGELSKGYYVKPTVFRGHNKMRIFQEEIFGPVVSVTTFKNEDEAL
EIANDTLYGLGAGVWTRDGTRAYRFGRQIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSDKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgcagagatgcagtttctgactaccgaattcccgtacaaaaagcagtatgcg
aattttatcggcggcgaatgggtgaagcccgtgggcggcgagtacttcgacaacatatcg
ccgatcaccggtgagccgttcacgtcgatcccgcgctcacgcgaagccgacatcgaactc
gcgctcgacgccgcgcatcgcgcgaaaacagcgtggggtaaaacgtcgaccaccgaacgc
gcgaacatcctgaaccgtatcgccgaccggatggaagcgaatctccaacgcatcgccgtg
gccgagacgatcgacaacggcaagccgctgcgcgaaacgatggctgcggatatcccgctc
gccatcgatcatttccgctatttcgccggcgccgtgcgtgcgcaggaaggcggcatctcc
gagatcgaccacgacaccgtcgcgtatcactttcacgaaccgctcggtgtggtcggccag
attatcccgtggaatttcccgatcctgatggcagtgtggaagctcgcacccgcattggct
gccggcaactgcgtcgtgctgaagccggccgagcaaacaccggcctcgattctcgtgctg
ctcgaactgatccacgatctgctgccgccgggcgtgctgaacgtggtgaacggcttcggc
ctcgaagccggcaaaccgctcgcgtcgaataagcgcatcgcgaagatcgctttcacgggt
gagacgaccacgggtcgcctgatcatgcagtacgcaagccagaacatcattccggtgacg
ctcgaactcggtggcaagagcccgaacattttcttcgccgacgtgatgaacgaagacgac
agctatttcgacaaggcgctcgaaggcttcacgatgttcgcgctgaatcagggcgaagtg
tgcacgtgcccgtcacgtgtgttgatcgacgaaaagatttacgaccgcttcatggaacgc
gcattgaagcgcgtggcggcgatcacgcaaggccatccgctcgacacgaaaacgatgatc
ggtgcgcaagcctcgcaggaacagctggaaaaaatcctctcgtacgtggatctcggcaag
caggaaggcgcggaatgtctcatcggcggcgagcgcaatacgctcggcggcgaactgagc
aagggatactacgtgaagccgaccgtgttccgcggccacaacaagatgcgcatcttccag
gaagaaatcttcggaccggtcgtttccgtgacgaccttcaagaatgaagacgaagcgctc
gagatcgccaacgatacgctctatggcctgggcgccggcgtatggacgcgtgacggcacg
cgtgcctatcgtttcggccggcaaatccaggcgggtcgcgtgtggaccaactgttatcac
gcgtatccggcgcatgccgcgttcggtggctacaagcaatcgggcattggccgcgaaaat
cacaagatgatgctcgaccactatcagcagaccaagaacctgctggtcagctatagcgac
aagccgcttggtttcttctaa

DBGET integrated database retrieval system