KEGG   Paraburkholderia fungorum: OI25_2022Help
Entry
OI25_2022         CDS       T03799                                 

Gene name
tkt
Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
bfn  Paraburkholderia fungorum
Pathway
bfn00030  Pentose phosphate pathway
bfn01100  Metabolic pathways
bfn01110  Biosynthesis of secondary metabolites
bfn01120  Microbial metabolism in diverse environments
bfn01130  Biosynthesis of antibiotics
bfn01200  Carbon metabolism
bfn01230  Biosynthesis of amino acids
Module
bfn_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bfn_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bfn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    OI25_2022 (tkt)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    OI25_2022 (tkt)
Enzymes [BR:bfn01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     OI25_2022 (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N TPP_enzyme_C E1_dh
Motif
Other DBs
NCBI-ProteinID: AJZ58379
LinkDB All DBs
Position
1:2267039..2269060
Genome map
AA seq 673 aa AA seqDB search
MTTPSPAPTSLMANAIRALSMDAVQKANSGHPGMPMGMAEIGVALWSRHLRHNPKNPQWA
DRDRFILSNGHGSMLLYSLLHLTGYDLPMEELKNFRQMHSKTPGHPEYGITPGVETTTGP
LGQGLANAVGMALAESLLATEFNKPDAKIVDHHTYVFVGDGCLMEGISHEACSLAGVLKL
NKLIAFYDDNGISIDGEVVHWFHDDTPKRFEAYGWNVIPNVVGHDVDAVDAAIKQAKLSD
KPTLICCKTVIGEGAPTKSGSHDSHGSPLGDKEIAATREAIGWKWEPFVIPQEVYAAWDA
TEAGARHESEWDKAFAAYAAKYPQEAAEFKRRDAKQLPADWKEKAQAIIAGANERKETVA
TRKASQQAIEGLSAVLPELLGGSADLTGSNLTNWKAAKPVRVNAEGKAAGNYVNYGVREF
GMSAAINGIALHGGFKAFGGTFLTFSDYSRNALRVAALMKAPSIFVFTHDSIGLGEDGPT
HQSIEHVASLRLIPNLQVWRPADTVETAVAWTHAVEHHGPSCLIFSRQNLPFSERTDAQI
ANIEKGGYVLRDWNDEIVARKIILIATGSEVELALNAVEPLAREGIAARVVSMPSTTVFD
KQDAEYRERVLPQGVRRVAIEAGVTDFWRKYVGLEGGVVGIDTFGESAPAGVLFKHFGFT
VEHVVETAKAALG
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccccgtctcccgcacccacctccctgatggctaacgcaatccgtgcgttgtcc
atggatgccgttcaaaaagcgaattccggccaccccggcatgccgatgggcatggccgaa
atcggcgtggccttgtggtcgcgtcatttgcgccacaacccgaagaacccgcagtgggcc
gatcgcgaccgtttcattctgtcgaacggccacggctcgatgctgctgtactcgctcctg
catctgaccggctatgacctgccgatggaagagctgaagaacttccgccagatgcactcg
aagacgccgggccacccggaatacggcatcacgccgggcgtcgaaacgaccaccggcccg
ctcggccagggtctcgcgaacgcagtcggcatggcgctcgccgaatcgctactcgccacc
gaattcaacaagcccgacgcgaagatcgtcgaccaccacacgtacgtgttcgtgggcgat
ggctgcctgatggaaggcatctcgcacgaagcctgctcgctcgcgggcgtgctgaagctg
aacaagctgatcgcgttctacgacgacaacggcatctcgatcgacggcgaagtggtccac
tggttccacgacgacacgccgaagcgcttcgaagcttacggctggaacgtgatcccgaac
gtggtcggccacgatgtcgatgcggtcgacgccgcaatcaagcaagccaagctgtcggac
aagcccacgctgatctgctgcaagaccgtgatcggcgaaggcgcgccgaccaagtccggc
agccatgattcgcacggctcgccgcttggcgacaaggaaatcgcggccacccgtgaagcg
atcggctggaagtgggagccgttcgtaatcccgcaggaagtctacgcagcgtgggatgcg
accgaagccggcgcgcgccacgaatccgagtgggacaaggcgtttgccgcctatgcggcc
aaatacccgcaggaagccgctgaattcaagcgccgcgacgcgaagcagttgcccgccgac
tggaaggaaaaggcgcaggccatcatcgccggcgctaacgaacgcaaggaaaccgtcgcg
acgcgtaaggcatcgcaacaggctatcgaaggtttgtcggccgtgctgccggaactgctc
ggcggctccgccgacctgaccggttcgaacctgaccaactggaaggccgccaagccggtg
cgcgtgaacgccgaaggcaaggccgccggcaactatgtgaactacggcgtgcgcgagttc
ggcatgagcgccgcgatcaacggcatcgcgctgcatggtggcttcaaggccttcggcggc
acgttcctgacgttctcggactacagccgcaacgcgctgcgtgttgccgctttgatgaag
gcgccgtcgattttcgtgttcacgcacgattcgatcggtctgggcgaagacggtccgacc
caccagtcgatcgaacatgtcgcaagcctgcgtctgattccgaacctacaagtgtggcgt
ccggctgatacggtcgaaacggcggtggcctggactcacgcggtcgagcatcacggcccg
tcgtgcctgatcttcagccgtcagaacctgccgttctcggagcgtaccgatgcgcagatc
gccaatatcgagaagggcggttacgtgttgcgcgactggaacgacgaaatcgtcgcgcgc
aagatcatcctgatcgccaccggttcggaagtcgaactggcgttgaacgctgtcgagccg
ctggctcgcgaaggcatcgcggcacgcgtcgtgtcgatgccgtcgaccacggtgttcgac
aagcaggacgccgagtaccgtgaacgcgtgctgccgcaaggcgtgcgccgcgtcgcgatc
gaagcgggtgtcacggatttctggcgtaagtacgtgggtctggaaggcggcgtggtcggc
atcgacacgttcggcgaatcggccccggctggcgtgctgttcaagcatttcggcttcacc
gtcgagcacgtcgtagagacggccaaagccgcactcggctga

DBGET integrated database retrieval system