KEGG   Paraburkholderia fungorum: OI25_2183Help
Entry
OI25_2183         CDS       T03799                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
bfn  Paraburkholderia fungorum
Brite
KEGG Orthology (KO) [BR:bfn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    OI25_2183
Enzymes [BR:bfn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     OI25_2183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: AJZ57297
LinkDB All DBs
Position
1:2451041..2452102
Genome map
AA seq 353 aa AA seqDB search
MTAIVCHAPKDYRVEQVAKPKARAHELVIRIAACGICASDCKCHSGAKMFWGGPSPWVKA
PVIPGHEFFGFVEEIGEGAADHFGVKLGDRVIAEQIVPCGKCRYCKSGQYWMCEVHNIFG
FQREVADGGMAEYMRIPPTAIVHKIPDGISLEDAAIIEPLACAIHTVNRGDLQLDDVVVI
AGAGPLGLMMTQVAHLKTPKKLVVIDLVEERLALAREYGADVTINPKQDDALAIVHSLTD
GYGCDVYIETTGAPIGVNQGMDMIRKLGRFVEFSVFGADTTLDWSVIGDRKELDVRGAHL
GPYCYPIAIDLLARGLVTSKGIVTHGFSLEEWDEAIKVANSLDSIKVLMKPRA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgatcgtctgccacgcaccgaaagactatcgcgtcgaacaggtagccaaaccc
aaggcacgcgcgcacgaactggtgatccgcatcgccgcgtgtggcatctgcgcgagcgac
tgcaaatgtcattcgggcgcgaagatgttttggggcggcccgagcccgtgggtcaaggcg
ccggtgattccggggcatgagttcttcggtttcgtcgaagaaattggcgagggcgcagcc
gatcatttcggcgtgaagctgggcgaccgcgtgatcgccgagcagatcgtgccgtgcggc
aagtgccgctattgcaaatccggccagtactggatgtgcgaagtgcacaacatcttcggc
tttcagcgcgaggtcgccgacggcggcatggccgagtacatgcgtattccgccgaccgcg
atcgtccacaagattcccgacggcatttcgcttgaagacgccgcgatcatcgaaccgctc
gcgtgcgcgatccacacggtgaaccgcggcgacctgcaactcgacgatgtggtggtgatt
gcgggcgcgggtccgctcgggttgatgatgacgcaagtcgcgcatctgaaaacgccgaag
aagctggtcgtgatcgatctggttgaggagcgcctggcactcgcgcgtgaatatggcgcg
gatgtgaccatcaatccgaaacaggacgatgcgttggcgatcgtccattcgctgaccgac
ggttatggttgcgacgtgtacatcgaaacgaccggcgcgccgatcggcgtcaatcagggc
atggacatgattcgcaagctagggcgtttcgtcgagttttcggtgttcggcgcggatacc
acgctggactggtcggtgatcggcgaccgcaaggagctcgatgtacgcggtgcgcatctc
ggcccatactgttatccgattgcgatcgacttgctggcgcgcgggctggtgacgtcgaag
ggtattgtcacgcacggcttttcgctggaagaatgggacgaagcgatcaaggtcgccaac
tcgctcgattcgatcaaggtgttgatgaaaccgcgcgcctga

DBGET integrated database retrieval system