KEGG   Paraburkholderia fungorum: OI25_2946
Entry
OI25_2946         CDS       T03799                                 

Definition
(GenBank) phage integrase family protein
Organism
bfn  Paraburkholderia fungorum
SSDB
Motif
Pfam: Phage_integrase DUF2188
Other DBs
NCBI-ProteinID: AJZ57714
LinkDB
Position
1:complement(3320099..3321196)
AA seq 365 aa
MASIRHRPQKNGAERWLVQVRRKGEPSVAKTFSTRQQAEEFANSAEKQVASAPKPAAKRA
TLVKARRSSPPPAPERLDDLEIGTIVSAFTARPREMKRHGDHAPTVIFHVGDATVDNITN
DWVLDYIDRLRSTTNKCGVVFAYSTIKKHMTLMKLAIEWRARNLRVFCPEFPFKIKDDFP
RDWENQRKRRLTRDEQFRLTAQLRKRQGESRYHWRLLVKLAVATGARLQELLKAEWSEFH
PEGLGWTIPKEHTKSFKERQVLFTGAARRTLRALKLLADPLDPRLFHTLEHIDTGSVSSG
FWTIVKTANIQDFCFHDLRHEAVTQITLKNPHIPQALLMKMTGHASFEVFDRYVNATFEE
MPRLN
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggcaagcattcgacacagaccccaaaaaaacggagccgagcgttggctcgtccaggtg
cgccgaaaaggagagccgagcgtggcaaagacgttctcgacccgacagcaagcggaggag
ttcgccaactcggcagaaaagcaggttgccagcgcacccaagcccgcagcgaaacgtgca
acgcttgtaaaagcgcgacgcagctccccaccgccagcgcctgagcgcttggacgatctg
gaaatcggaacgattgtctccgcgttcacggcgcgccctcgtgaaatgaagaggcatggc
gaccatgcgcccacagtcatctttcatgtcggcgacgcgacggtcgacaacatcaccaat
gattgggtcttggactacatagaccggctgcgttcaacaacgaacaagtgcggtgtcgtc
ttcgcctactcaacgatcaagaaacacatgacgttgatgaagttggcaatcgagtggcgt
gccagaaatttgcgggttttctgccctgaattcccgttcaaaataaaggacgactttcct
cgcgattgggaaaaccagcgcaaacggcgactgactcgggacgagcaatttcggttgacg
gctcaattgagaaagcgacaaggcgagtcccgctaccactggcgtttgttggtcaaatta
gccgtggcgacaggcgctaggctccaagaattgttaaaagccgaatggagcgaatttcac
ccagagggactcggatggaccatcccgaaagaacacacaaagtcgttcaaggaacgccaa
gtgctgttcacgggtgcggctcgacgaacgcttagggcgttgaagctactcgccgaccct
ctcgatccaagactgtttcatacgctcgagcacattgacacggggtcagtctcgtctgga
ttctggacgatcgtgaagacagccaacattcaagatttctgttttcatgacctgcgccac
gaagccgtcactcaaatcaccctgaagaacccgcatatcccacaggccctgctgatgaaa
atgacgggccatgcatcgttcgaggtgtttgatcgatacgtcaacgccaccttcgaagaa
atgccgcggttgaattga

DBGET integrated database retrieval system