KEGG   Paraburkholderia fungorum: OI25_3089
Entry
OI25_3089         CDS       T03799                                 

Definition
(GenBank) glycosyl hydrolases 31 family protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
bfn  Paraburkholderia fungorum
Pathway
bfn00052  Galactose metabolism
bfn00500  Starch and sucrose metabolism
bfn01100  Metabolic pathways
bfn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    OI25_3089
   00500 Starch and sucrose metabolism
    OI25_3089
Enzymes [BR:bfn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     OI25_3089
SSDB
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF4968 DUF5110
Other DBs
NCBI-ProteinID: AJZ60521
LinkDB
Position
1:complement(3467785..3470199)
AA seq 804 aa
MTNLKHPPRFSVASHAGNHIVLAAQENCRIELFVLADDIVRVLVLPDGEMHGPRTWSIAP
GADDVPLEGRERRDVSGFTPPRFELAADAEQVVIETARVRLTVTLNGGFCAWDILHDAAW
HRVMSDRKTQAYNFGWWDARAYHYIERRKDEMYVGLGERAGSLNRADQAYEMRNIDAMGY
SARTTDPLYKHIPFYVTWQSQTSTGFGLFYDTLADCRFDMGRELDNYHGHYRHFVAEHGD
LDYYFIASAGTPLHAVRRFTWLTGRPAWMPKWGLGYSGSTMSYTDAPDAQQRMGEFIARC
REHDVLCDSFHLSSGYTSIGAKRYVFNWNHTKFPDIDGFVQSYLGHGVRLCANIKPCLLQ
DHPAFDEVARAGLLIASRNGDPAWVQFWDEVGAYLDFTNPATIDWWKARVKDSLLKYGIA
ATWNDNNEFEIWSPDAIAQGFGQPYPAREAKVLQTQLMMRASHDAQREHAPERRPFLVSR
SGGVGMQRYVQTWSGDNYTSWETLRFNLKMGLGLAMSGVSNSGHDIGGFSGPAPGPELLA
RWVAFGIFLPRFSIHSWNDDGTVNEPWMHPEVTRQVADLIKLRYRLIPYLYELLWQSHSA
YEPVLRPMFAEFPHDPRCLVDGDDMMLGSSMLVAPVVEAGQSTRDVYLPAGTHWVSYWSG
EVFDGGQTVNLPAPFEQPVTLLREGSVIPLNIAEQHFGRPADERAFIAVPHIGTGTARGG
CVEDDGESEAWRTGEQGRWNVAITSDASTLRVSVAREGWIQQPQQEVRLFVPASDVREVV
CTDGKLVSEHTADGWRCLTISIAH
NT seq 2415 nt   +upstreamnt  +downstreamnt
ttgacgaatctgaaacatccaccgcgcttttcggtggcctcccatgccggcaatcacatc
gttctcgccgcgcaggaaaactgccggattgagttgttcgttctcgccgacgacatcgtc
cgtgtactcgtgttgccggatggcgaaatgcacggcccgcggacatggtccatcgcgccg
ggcgccgacgacgttccgctcgaaggacgcgaacgccgggacgtaagcggtttcacgccg
cctcgcttcgagctggcggccgacgccgagcaggttgtcattgaaacggcacgcgtgcgt
ttgaccgtcacactgaacggcggattctgcgcatgggacatcctgcacgacgcggcgtgg
catcgcgtgatgagcgatcgcaagacccaggcgtacaacttcggctggtgggacgcgcgc
gcgtatcactacattgagcgtcgcaaggacgaaatgtatgtgggcctcggagagcgcgcc
ggttcactcaaccgtgcggaccaggcctacgaaatgcgcaacatcgacgcgatgggctat
agcgcgcgcaccacggatccgctctacaagcacatcccgttctacgtcacgtggcagtcg
caaacgtcgacaggattcggcctgttctacgacacgctcgccgattgccgcttcgacatg
ggccgcgagctcgacaactatcacggtcactaccggcacttcgtcgccgaacacggcgac
ctcgactattacttcatcgcgtctgcgggtacgccccttcacgcggtgcgccgctttacg
tggctgaccggacgcccggcctggatgccgaaatggggcctgggctactccggctcgacg
atgagctacaccgacgcgcccgacgcccagcagcgaatgggcgaattcatcgcgcgctgc
cgcgagcacgacgtgctgtgcgattcgttccatttgtcgtcgggctatacgtcgatcggc
gcgaagcgttatgtgttcaactggaaccacacgaagtttcccgatatcgacggcttcgtg
cagagctatctcgggcatggcgtgcgtctgtgcgcgaacatcaaaccctgcctgttgcag
gatcatcccgcgttcgacgaagtggcgcgcgccggcctgctgatcgcgtcgcgcaacggc
gatccggcgtgggtgcagttctgggacgaagtgggcgcgtatctggactttacgaacccc
gccactatcgactggtggaaagcccgcgtgaaagacagtctgttgaagtacggtattgcg
gcaacctggaacgacaacaacgagttcgaaatctggtcgcccgacgcgatcgctcagggc
ttcggccaaccgtatccggcacgcgaggcaaaggtgctgcaaacgcagttgatgatgcgc
gcctcgcacgacgcgcagcgcgaacatgcgcccgagcgtcgcccgttcctcgtgtcccgc
tcaggcggggtcggcatgcaacgctatgtgcagacatggtccggcgacaactacacgtcg
tgggaaacgctgcgcttcaatctgaagatgggccttgggctagccatgtccggcgtgtcg
aacagcggccacgatatcggcggattctcgggtccggcgccaggcccggagttgctcgcc
cgctgggtcgccttcggcatcttcctgccgcgtttcagcattcattcatggaacgacgac
ggcacggtcaacgaaccctggatgcaccccgaagtcacgcgacaggtggcggatctgatc
aaactgcgctaccggctgattccctacctgtatgagttgctgtggcaatcgcacagtgcc
tatgaaccggtattgcgtccgatgttcgccgagttcccgcacgatccgcgctgtctcgtc
gacggcgacgacatgatgctgggttcgtcgatgctggttgcaccggtggtcgaggcgggt
caatcgacgcgcgacgtttatctgccggccggcacgcattgggtgtcgtactggagcggt
gaggtgttcgacggcggtcagacggtgaacctgccggctccattcgaacagccggtgaca
ttgctgcgcgaaggcagcgtgattccgttgaacatcgctgaacagcactttggccgcccc
gccgatgaacgtgcattcatcgctgtgccgcacatcggcacgggcaccgctcgcggcggt
tgcgtcgaagacgacggtgaaagcgaagcctggcgcacgggcgagcaaggccgctggaat
gtagcgattacaagcgacgcgagcaccttgcgcgtttcagtcgcgcgagaaggctggatt
cagcagccgcaacaagaagtccggctgttcgtgccggcaagcgacgtgcgcgaggtcgtt
tgcaccgacggcaagctggtatccgagcacacggctgacggctggcgatgtctgacaatt
tccatcgcccactag

DBGET integrated database retrieval system