KEGG   Paraburkholderia fungorum: OI25_3429Help
Entry
OI25_3429         CDS       T03799                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bfn  Paraburkholderia fungorum
Pathway
bfn03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bfn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    OI25_3429 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bfn03400]
    OI25_3429 (ligD)
Enzymes [BR:bfn01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     OI25_3429 (ligD)
DNA repair and recombination proteins [BR:bfn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     OI25_3429 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AJZ57787
UniProt: A0A0D5V749
LinkDB All DBs
Position
1:3843198..3845963
Genome map
AA seq 921 aa AA seqDB search
MKDRLDLYNRKRRFDETPEPPGAAARKKGRGTAARASNEALAYVIQEHHARRLHYDFRLE
LNGTLLSWAVPKGPSLDPSVKRLAVHVEDHPVEYGSFEGEIPPGHYGAGTVIVWDRGTWE
PNGGAAQAARSYQAGKLKFHLHGEKLHGGWTLVRSHMRGSGDKEQWLLIKERDDEARSEN
EYDVVTALPGSVLNGSAPTEGRPGPGGRAKKTKTATKTATKTATKTATKTATKTPSESAN
GNASASRKARTTQAIIASPSIEGAVKAALPATFKPQLATLVDTAPPGDEWAYEIKFDGYR
VLARIDRKAKTRAVKVFTRAGNDWTAKFGEQVKAFEQLDIESGWLDGEAVVLDENGLPNF
QALQNAFDSNRPQDIVIYLFDVPFLNGYDLRNVPLEQRRAILRAVMDKHDKDKHNGDKHD
GGVLRFSNDFAFSADELLKSACDVALEGIIGKRRDSGYVSGRSSAWIKLKCRRRQEFVIG
GYSEPSGSRAAFGALLLGIYDDAGKLRYAGRVGTGFDAALLASVKKALDAHETRHMPFAS
APRERSRSPVHWVEPVLVCECNFAEWTSDGIVRQASFVSLRNDKPARQIIKEDPRQGADV
QERTDAASETVPKKRTSKSKNAAAPAEVAGVRVSHPDRIIDKSTGARKIDLVHYYESVAD
WMLPHLHDRPVSLVRAPKDIGGELFFQKHSQKLSIPNVTQHPGLDPGHPPLITVDTLKAL
VGAAQMGTVEFHTWNALVSNIEKPDRMVFDLDPDASLGWERMIEAAQLTRSLLEELGLTS
FCKTSGGKGFHVVVPLAKHAGWDDVKAFAQAVAQHMAATLPTHFSAKMGAQNRKGKIFVD
YLRNNRGSSTVAAFSARARPGLGVSVPLAWDEVATTTSGDQWTIENVHERLKDLKRDPWA
DYAKTRQRITAAMKKRLDEAQ
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaccggctcgatctgtacaaccgcaagcggcgcttcgacgaaactccggagccg
ccgggcgccgctgcgcgcaagaagggtcgcgggacggcggcgcgcgcatcgaacgaggcg
ttggcgtatgtgattcaggagcaccacgcacggcgcctgcactacgacttccggctcgaa
ctgaatggcaccttgctgtcgtgggcggtgcccaaggggccgagcctcgacccgtcggtg
aagcggctcgcggtgcatgtcgaggatcatccagtcgaatatggctcgttcgaaggcgag
attccgccggggcactacggtgcgggaacggtgatcgtatgggaccggggaacgtgggag
ccgaacggcggcgcagcgcaagccgccaggtcgtatcaggcgggcaagctcaaattccat
ctccacggcgaaaaactacacggcggctggacgctggtgcgcagccacatgcgcggaagc
ggcgacaaggagcagtggctgctgatcaaggagcgcgacgacgaagcccgtagcgagaat
gaatacgacgtcgtaacggcgctgccaggcagcgtattgaacggcagcgcgccaactgaa
gggcggcccggacccggcgggcgcgcgaagaaaacgaagaccgcaacgaagaccgcaacg
aagaccgcaacgaagaccgcaacgaagaccgcaacgaagaccccaagcgagtctgcaaac
gggaacgcaagcgcaagcaggaaggcgcgcacaacgcaggcgattatcgcttccccttcg
atcgaaggcgcggtcaaagccgcgttacccgccacgttcaagccgcaactggcgacgctc
gtcgacaccgcgccacccggcgacgaatgggcctacgaaatcaagttcgacggttatcgc
gtgctagcccgcatcgatcgaaaagcgaagacccgtgcggtcaaggtgttcacgcgcgcg
ggcaacgactggaccgcgaagttcggcgagcaggtgaaggcgttcgaacaactcgacatc
gaaagcggctggctcgacggtgaagccgtggtgctcgatgaaaacggtctgccgaatttt
caggcgctgcagaacgcgtttgattcgaaccgtccgcaagacattgtgatctatctgttc
gacgttccgtttctgaacggctacgacttgcgcaatgtgccgctcgaacagcgtcgcgcg
attttgcgtgcggtaatggataagcacgacaaggataagcataacggggacaagcacgac
ggcggcgtgcttcgcttctccaacgacttcgcgttcagtgccgacgaactattgaagagc
gcgtgcgacgtagcgctcgaagggattatcggcaaacggcgcgatagcggctacgtgtcg
ggacgctcgtccgcgtggatcaaattgaagtgccggcggcgccaggagttcgtgatcggc
ggctattcggagccgtccggcagccgtgcggcgttcggcgcgttattgctcggcatctac
gacgacgcgggcaaattgcgctacgcaggacgcgtcggcacagggttcgacgctgcactg
ctggcctcggtcaaaaaggcgctcgacgcgcacgagaccaggcatatgccgtttgccagc
gcgccgcgcgagcgcagccgctcgccggtgcactgggtcgaaccggtgctcgtctgcgaa
tgcaacttcgctgaatggacgagcgacggcatcgtgcggcaggcatcgttcgtgagtctg
cgtaacgacaaaccggcacggcaaatcatcaaggaagatcctcgtcaaggagccgacgtg
caagagcgaaccgatgccgcatccgaaaccgtgccgaagaagcgcacgtcgaaatcaaag
aatgccgcggcaccagccgaagtcgccggcgtgcgcgtctcgcatcccgaccgcatcatc
gataagagcaccggcgcccggaaaatcgatctcgtgcactactacgaatcggtcgccgac
tggatgctgccgcatctgcatgaccggccggtatcgctggtgcgcgcgcctaaggacatc
ggcggcgaactgtttttccagaagcacagccagaaactgtcgatccccaacgtcacgcag
catcccgggctcgaccccggccatccgccgctgatcacggtcgacacacttaaggcgctg
gtcggcgccgcccaaatgggtaccgttgaatttcatacctggaatgcgttggtgtcgaac
atcgaaaaaccggatcgcatggtgttcgatctcgaccccgacgcgtcgctcgggtgggag
cggatgatcgaagccgcgcaactgacgcgttcactgctcgaagagctcggactgacctcg
ttctgcaagacgagcggcggcaaaggtttccacgtggtggtgccgctcgcgaagcacgcc
ggctgggacgatgtaaaagcgtttgcgcaagcggtcgcacaacatatggcagcgacgttg
cccacgcatttcagcgcgaagatgggggcgcagaatcgcaaggggaagatctttgtcgat
tacctgcgcaacaaccgcggctcgagcacggtagctgctttctcggcacgcgcccggccg
gggctgggggtctcggtgccgcttgcatgggacgaagtcgcgaccacgacgagcggcgat
cagtggaccatcgaaaacgttcacgaacggctcaaggatctgaagcgcgacccgtgggcg
gactacgcgaagacgcgccagcgcattacggcggcaatgaaaaaacgtctggatgaagcg
cagtga

DBGET integrated database retrieval system