KEGG   Paraburkholderia fungorum: OI25_404Help
Entry
OI25_404          CDS       T03799                                 

Definition
(GenBank) putative gst-related protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bfn  Paraburkholderia fungorum
Pathway
bfn00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bfn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    OI25_404
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bfn02000]
    OI25_404
Enzymes [BR:bfn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     OI25_404
Transporters [BR:bfn02000]
 Other Transporters
  Pores ion channels [TC:1]
   OI25_404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_N_4 Tom37
Motif
Other DBs
NCBI-ProteinID: AJZ59739
UniProt: A0A0D5VD22
LinkDB All DBs
Position
1:complement(470492..471139)
Genome map
AA seq 215 aa AA seqDB search
MIKLCGFALSNYYNKVKFVLLEHGIPFEEVFVKPSQEEAMLEHSPLGKVPYIQTEHGDLC
ESQAIVEYLAARFPDKAIFSADPWEAAKERELITFVDVHLELTVRNLYKEAFFGGTVTDA
TKGRVEKLLVHHIAGFKRIAKFAPYLRGERFSVADAAGYVSLPLVGMATQIVYGRDFLLD
AGVDWKSYVKAINSRPAAQRVSEDRKAAVAASRPA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctgtgcggtttcgcgctctctaactattacaacaaggtgaagttcgtgctc
ctcgaacacggcattccgttcgaagaagtgttcgtgaagccgagccaggaagaggcgatg
ctcgagcattctccgctcggcaaggtgccttacattcagactgagcacggcgatctgtgc
gaatcgcaagccattgtcgaatatctggccgcgcgttttcccgacaaggcgattttctcc
gctgacccatgggaagcggccaaggagcgcgagttgatcacgttcgtggatgtgcatctc
gaactgaccgtacgcaacctctataaagaagcgttcttcggcgggaccgtgaccgacgcg
accaaagggcgtgtcgagaagctgctcgtgcatcacatcgccggcttcaagcggatcgcg
aaattcgcgccttatttgcgcggcgagcgtttcagtgtcgccgacgcagcagggtatgtg
agcctgccgctggtcggtatggcgacgcagatcgtctatggccgcgatttcctgctcgac
gccggcgtggactggaaaagctatgtgaaggcgatcaactcccggccggccgcacagcgc
gtgagcgaggaccgtaaagcggctgtcgcggcctcgcgcccggcgtga

DBGET integrated database retrieval system