KEGG   Paraburkholderia fungorum: OI25_4536Help
Entry
OI25_4536         CDS       T03799                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bfn  Paraburkholderia fungorum
Pathway
bfn00440  Phosphonate and phosphinate metabolism
bfn01100  Metabolic pathways
bfn01120  Microbial metabolism in diverse environments
bfn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bfn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    OI25_4536 (aepX)
Enzymes [BR:bfn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     OI25_4536 (aepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AJZ63926
UniProt: A0A0D5VPB7
LinkDB All DBs
Position
2:complement(635109..636830)
Genome map
AA seq 573 aa AA seqDB search
MNAREPAFIPVSRSARLRQMLVSNELEFMMEAHNGLSARIVREAGFKAIWGSGLAISAQF
GVRDNNEASWTQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIE
DKQFPKTNSFINGEAQPLADMDEFCGKIKAGKDSQSDENFSIVARVEALIAGWGMDEALR
RAEAYRQAGADAILIHSKLSRPDEILEFAREWAGRGPLVIVPTKYYSTPTEVFREAGIST
VIWANHLIRAATSAMQAVAKEIHSSETLVNVEDSIAAVNEIFRLQDADEYSEAEDRYLSS
GRSAGSAIVLAASRGKGLEAVTEDRPKVMLPIAGKPLLRWLVDAFKKQSVNDITVVGGYR
ADAIDTAGIKLVVNERHAQTGELASLACAAGKLAGDTVISYGDLLFRSYILRDLVESEAA
FSVVVDSSLTDAENASVRDFAWCSAADDRGLFGNKVTLRHVSSGQEASSAIASQTPHGRW
VGLLNVRGEGRERLQAVLGKLQARPDFDSLDMPALLNALIEAGEAIEVQYVHGHWRGVND
LEDFRRAGDFAHAQAPFAAAAGGKTNEASGAAQ
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccgcgaacccgcattcatcccggtttcccgcagcgcacgcctgcgccagatg
ctcgtcagcaacgaactcgaattcatgatggaggcccataacggtctctccgcccgcatc
gtccgcgaagcgggcttcaaggccatctggggttcgggtctcgcgatctccgcccaattc
ggcgtgcgcgacaacaacgaagcgagctggacgcaagtcgtcgataacctcgaattcatg
gccgatgccagcgatctgcccatcctcctcgacggcgataccggctacggcaacttcaac
aacgtgcgccgcctcgtgcgcaaactcgaacagcgcggcatcgccggcgtctgtatcgaa
gacaagcaattcccgaaaacaaacagcttcatcaacggcgaagcccagccgctcgccgat
atggacgagttctgcggcaagatcaaagccggcaaagactcgcagtcggatgaaaatttc
tcgatcgtcgcccgcgtcgaagcactcatcgccggctggggcatggacgaagcgctgcgt
cgcgcggaagcctatcggcaagcaggcgcggacgcgatcctgatccacagcaagctctcg
cgccccgatgaaattctcgagttcgcacgcgaatgggcgggccgcgggccgctcgtcatc
gtgccgaccaagtactacagcacgcccaccgaagtgttccgcgaagccggcatcagcacg
gtgatctgggcgaatcatctgatccgcgcggcaacctcggccatgcaggccgtcgccaag
gaaattcactcgagcgaaacgctcgtcaacgtcgaagacagcatcgcggccgtcaacgaa
atctttcgtctgcaagacgcggacgaatactcggaagccgaagaccgctatctgtccagc
gggcgctcggccggctctgccatcgtgctcgcggccagccgcggcaaggggctcgaagcc
gtcaccgaagaccgtccgaaagtcatgctgccgatcgcgggcaagccgctgttgcgctgg
ctcgtcgacgcgttcaagaagcaaagcgtcaacgacatcaccgtggtcggcggttatcgc
gccgatgcgatcgacacggccgggatcaagctggtcgtcaacgaacgccacgcgcaaacc
ggcgagttggcgtcgctcgcctgcgcggccggcaagctcgcgggcgataccgtcatctcc
tacggcgatctgctgttccgcagctacatcctgcgcgatctggtcgaaagcgaagccgcg
ttcagcgtcgtggtggattcgtcgctgaccgatgcggaaaacgccagcgtgcgcgacttc
gcatggtgctcggcagccgacgatcgcggtctgttcggcaacaaggtcacgctgcgtcac
gtgtcgagcgggcaggaagcaagctcggccatcgcttcgcaaacgccgcatggccgctgg
gtgggtctgctgaacgtgcgcggcgaagggcgtgagcgtctgcaagcggtgctgggcaag
ttgcaggcgcgcccggatttcgattcactcgacatgcccgcgctgctcaatgcgctgatc
gaagcaggtgaggcgatcgaagtgcaatacgtgcacggccattggcgcggcgtgaacgat
ctggaagacttccgtcgcgccggcgatttcgcgcatgcgcaagcgccgtttgcggcagcg
gccggcggcaagacgaacgaagccagcggagcagcgcaatga

DBGET integrated database retrieval system