KEGG   Paraburkholderia fungorum: OI25_5278Help
Entry
OI25_5278         CDS       T03799                                 

Gene name
treS
Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bfn  Paraburkholderia fungorum
Pathway
bfn00500  Starch and sucrose metabolism
bfn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OI25_5278 (treS)
Enzymes [BR:bfn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     OI25_5278 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     OI25_5278 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap APH hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AJZ61194
UniProt: A0A0D5VH12
LinkDB All DBs
Position
2:1453202..1456657
Genome map
AA seq 1151 aa AA seqDB search
MKRDDPAQTPPQASTNVSTGSATKARSHRRGKPAALSDDPLWYKDAIIYQVHIKSFFDAN
NDGVGDFPGLIAKLDYIAELGVNAIWLLPFYPSPRRDDGYDIADYRNVHPDYGQLSDVKR
FIQEAHARGIRVITELVINHTSDQHPWFQRARRAKPGSNHRNYYVWSDTDQKYQETRIIF
IDSEPSNWTHDPVAGAYYWHRFYSHQPDLNFDNPAVLKEVLQIMRFWLDMGIDGLRLDAV
PYLVEREGTNNENLPETHEVLKKIRATIDAEYPNRMLLAEANQWPEDVKEYFGDEDECHM
AFHFPLMPRIYMSIASEDRFPITDIMRQTPDLAPSNQWAIFLRNHDELTLEMVTDSERDY
LWNTYASDRRARLNLGIRRRLAPLMERDRRRIELINSLLLSMPGTPVIYYGDELGMGDNI
HLGDRDGVRTPMQWSSDRNGGFSRADPEQLVLPPVMGALYGFDAVNVEAQSRDPHSLLNW
TRRMLATRRAKQTFGRGTIRFLKPENRKILAYLRELPGEPPILCVANLSRAPQAVELDLS
EFNGAVPVEMTADSVFPAIGQLTYLLTFPPYGFLWFLLCSGGQRPTWAQAHSEPLPEFVT
IVIREGQVGPTPENVRLLESEVLPSWLSRRRWFASKDQKMHAVRLAALTTIPQGGFAFTE
IEADVGDHTERYVVPIAITWGGETTTPLFLQLALARVRRGRNVGHLTDAFALPIFAHGVL
RKLRERAVIPTVQKSEIRFIPTERFSELAHLGEQPEIRWLAAEQSNSSLIIADAAVLKLV
RRLVSGIHPEAEISRYLTQLGYANTAPLYGEVVRVDPEGVPHTLAILQGYIDNQGDAWNW
SLDYLRRSVDELAIAVDTEAQSPDRDNEAILVDGYSALAGIIGKRLGELHVALASPSDDP
AFAPEPASAEQVKAWVDGTQSMLASALDLLAPRIEQMSDPDTKALAQSLIDRRAALVDAV
SKLISGNAGALRTRIHGDFHLGQVLVAQGDAYLIDFEGEPARTLEERRQKSSPLRDVAGL
MRSLSYASAAAQSTTESAPVQTADRKRALFERFRAHATETFLKEYRAAAAASPTQLVAPE
AEQALLDLFLIEKAAYEIRYEAANRPTWLSLPVRGLAALTSRLLGDTGKHDPSTQAPGAA
APPTPAEGDYE
NT seq 3456 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtgacgatccagcccaaactccgccgcaagcctcgaccaacgtgagcaccggc
agcgccaccaaagcgcgctcgcatcggcgcggcaaacccgcggccttgagcgacgatccg
ctctggtacaaagacgcgatcatttatcaggtacacatcaagtcgttcttcgacgcgaac
aacgacggcgtaggcgactttcccggcctgatcgcgaagctcgattacatcgccgagctc
ggtgtcaatgcgatctggctgctgccgttctatccatcgccgcgccgcgacgacggctac
gatatcgccgactatcgcaatgtgcatccggactacggccagctgtccgacgtgaagcgc
ttcattcaggaagcgcacgcacgcggcatccgcgtgattacggagctggtgatcaaccac
acgtcggatcagcacccatggtttcagcgcgcgcgccgcgcgaaaccggggtcgaatcat
cgcaactactacgtgtggtccgataccgatcagaagtaccaggaaacgcggatcatcttt
atcgattcggagccgtcgaactggacccatgacccggttgcgggtgcttactattggcac
cgcttctattcgcaccagcccgatctgaacttcgacaatccggccgtgctgaaggaagtg
ctgcagatcatgcgcttctggctcgatatggggatcgacgggctgcggctcgacgccgtg
ccgtatctggtcgaacgcgaaggcaccaacaacgagaatctgccggaaacgcacgaggtg
ctgaagaagattcgcgcgaccatcgacgccgagtacccgaaccgcatgctgctcgccgaa
gcgaaccagtggccggaagacgtgaaggaatatttcggcgacgaagacgaatgccacatg
gcgttccatttcccgctgatgccgcgcatctatatgtcgattgcgagcgaagaccgcttc
ccgattaccgacatcatgcgccagacgccggacctcgcccccagcaatcagtgggcgatt
ttcctgcgcaatcacgatgaactgacgctcgaaatggtcacggattccgagcgcgactat
ctgtggaacacctatgcaagcgatcggcgcgcgcgtctgaatctcggcattcgccgccgt
ctcgccccgctgatggagcgtgatcgccgccgcatcgaactgatcaactcgctgctgctg
tcgatgcccggcacgcccgtgatctattacggcgacgaactcggcatgggcgacaacatc
caccttggcgaccgcgacggcgtgcgcacgccgatgcaatggtcgtcggatcgcaacggt
ggattctcgcgcgccgatcccgagcaactggtgctgccgccggtaatgggcgcgttgtac
ggcttcgacgccgtcaatgtcgaagcgcaaagccgcgacccgcattcgctgttgaactgg
acccggcgcatgctcgccacgcggcgcgcgaaacagactttcggacgcggcacgatccgt
ttcctgaagccggagaaccgtaaaatcctcgcgtatctccgcgaattacccggcgagccg
ccgatcctgtgcgtggcgaatctgtcacgcgcaccgcaagcggtcgagctggatctatcc
gaattcaatggcgcggtgccggttgaaatgaccgcggattccgtattccccgcgatcggc
cagctcacctatctgctgacctttccgccgtacggtttcctgtggttcttgctgtgttcg
ggcggccaacgcccgacctgggcgcaggcgcattccgagccgctgcccgaattcgtcacg
atcgtgatccgcgaaggccaggtcggtccgacaccggaaaacgtccgcttgctcgaatcc
gaagtgctgccgtcgtggctgagccggcgccgctggtttgcctccaaggatcagaagatg
cacgcggtgcggctcgccgcgttgaccacgattcctcaaggcggcttcgcgttcaccgaa
atcgaagccgacgtgggcgaccataccgaacgttacgtcgtgccgatcgcgatcacatgg
ggcggtgaaaccaccacgccgctattccttcaactggcactggcgcgcgttcgccgtggc
cgcaatgtcggccatctgaccgacgcgttcgcgctgcccatcttcgcccacggggtattg
cgcaagctgcgcgagcgcgcggtgattccgaccgtgcagaagagtgagatcaggttcatc
ccgaccgagcgtttctccgaactcgctcatctcggcgagcagcccgagattcgctggctg
gcggccgaacagagcaacagctcgttgatcatcgccgatgccgcggtgctgaaactggtg
cggcgtctggtgagcggtatccatccggaagccgaaatcagccgctatttgacccagctc
ggctacgcgaacaccgcgccgctgtatggtgaagtggtgcgcgtcgatcccgaaggcgtg
ccgcatacactcgcgatcttgcaaggctatatcgacaaccagggcgacgcgtggaactgg
tcgctcgactacctgcgccgctcggtggatgaactcgccatcgcggtcgatacggaagca
caatcgccggaccgcgacaacgaagcgattctcgtggacggctacagtgcgctcgccggc
atcatcggcaagcgcctgggcgaattgcatgtggcgctcgcctcgccttccgacgacccg
gcgttcgcccccgaaccggccagcgccgaacaggtgaaggcgtgggtcgacggcacgcaa
tccatgctcgcgagcgcgctcgatctgcttgcgccgcgtatcgagcagatgagcgatccg
gacaccaaagcgttggcgcaaagcctgatcgaccgtcgcgcggcgctggtcgacgcggtc
agcaaactgatatcgggcaacgcaggcgcgttgcgcacgcgcattcacggcgacttccat
ctcgggcaggtgctggtcgcgcagggcgacgcgtatctgatcgacttcgaaggcgagccc
gcgcgtaccctggaggagcggcgccagaaatcgagtccgctgcgcgacgtcgctggcttg
atgcgttcgctgtcctatgcgagcgccgcggcgcagtccacgacggaaagcgcgccggtg
cagaccgccgatcgcaagcgcgccctttttgagcgtttccgtgcgcacgccaccgaaaca
ttcctgaaagaataccgggccgctgccgccgcttcgccgacgcaactggtcgcgccggaa
gccgaacaggctctgctcgatctgttcctgatcgagaaagccgcgtacgaaatccgttac
gaagcggccaatcggccgacgtggctcagtctgccggtacgcggccttgccgcgctcacc
agccgcctgctcggcgacaccggtaagcacgatccgtcaacccaggcgccaggcgccgcc
gcaccgcctaccccggccgagggcgattatgagtga

DBGET integrated database retrieval system