KEGG   Paraburkholderia fungorum: OI25_6964Help
Entry
OI25_6964         CDS       T03799                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bfn  Paraburkholderia fungorum
Brite
KEGG Orthology (KO) [BR:bfn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    OI25_6964 (ahpF)
Enzymes [BR:bfn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     OI25_6964 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like K_oxygenase Glutaredoxin DAO FAD_oxidored NAD_binding_8 FAD_binding_3 Thi4 FMO-like AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AJZ63804
UniProt: A0A0D5VPL7
LinkDB All DBs
Position
2:3345326..3346918
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLKSYLEKVSRPIEIVASLDDSAKSQELLALLNDIATLSERVTVIERRGDSE
RKPSFSIGEPGKETGIRFAGIPMGHEFTSLVLALLQVGGHPVKLDDAVIEQIRNLDGDYQ
FETYFSLSCQNCPEVVQALNVMALLNPRIRHVAIDGALFQNEVEARQIMAVPTMFMNGEV
FGQGRSGVKEILAKLDTNAGARAAKELEKKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTLAIENFVSVTETEGPKFAMALEQHVKSYEVDIMDVQRAEALIPGRINE
VRLANGAVLKAKTIVLATGARWREINVPGEREYRNHGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGLVREVTLLEFGAQLRADEVLQRKLRSLANVTIVTQAQTTEITGDGKKV
NGLVYKDLRSGETKSIELEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLSAFDHLIRNSDADEVVSEAEAEAAV
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaatctcaagactcagttgaaatcctacctcgagaaggttagcagacct
atcgagatcgttgcttcgctcgacgacagcgcgaaatcgcaagagctgctggcgttgctg
aacgatatcgcgacgttgtcggaacgcgtcaccgtgatcgaacgccgcggcgacagcgag
cgcaagccgtcgttttcgatcggcgaaccgggtaaggaaacgggcatccgtttcgccggt
attccgatggggcatgaattcacgtcgctcgtcctcgcgctgttgcaggtcggcggccat
ccggtcaagctcgacgacgcggtgatcgaacagatccgcaatctcgacggcgactatcaa
ttcgaaacgtatttttcgctgtcatgccagaactgcccggaagtcgtccaggcgctgaac
gtgatggcgctgctcaacccgcgcatccgtcacgtggcgatcgacggcgcgctgttccag
aacgaagtcgaagcgcgccagatcatggcggtaccgaccatgttcatgaacggcgaagtg
ttcggccagggccgcagcggtgtgaaggaaatccttgccaagctcgacaccaatgccggt
gcgcgtgctgcgaaggaactggaaaagaagccggtgttcgatacgctgatcgtcggcggc
ggccctgccggcgcggccgcggcgatttactcggcgcgtaagggcattgccacgggcgtg
gtggccgagcgcttcggcggccaggtgctcgatacgctggcgatcgagaatttcgtctcc
gtcacggaaacggaaggaccgaagttcgcgatggcgctcgaacagcacgtgaagagctac
gaagtcgacatcatggacgtgcagcgcgccgaagcgctgatcccgggccgcatcaacgag
gtgcgtctggcgaatggcgcggtgctgaaggcaaagacgatcgttctggcaaccggcgcg
cgttggcgcgaaatcaacgtgccgggcgagcgcgagtaccgtaaccacggcgtggcgtac
tgcccgcactgcgatggtccgctgttcaagggcaagcgcgtggcggtgatcggcggcggc
aactcgggagtcgaagcggcgatcgatctcgcgggtctggtgcgtgaagtgacgctgctg
gaattcggtgcgcaactgcgtgccgacgaagtgctgcaacgcaagctgcgcagtctcgcc
aacgtgaccatcgtgacgcaggcacagactacggagatcaccggcgacggcaagaaggtc
aacggtctggtctacaaggacctgcgctcgggcgaaacgaagagcatcgagctcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgaatggctgaagggcacggtcgagttg
tcgaagcacggcgagatcgtcgtcgatgcgcgcggcgccacgtcggtgccgggcgtgttc
gcggccggcgacgtgaccacggttccgttcaagcagatcgtgattgccgtaggcgagggt
gcgaaggcgtcgctttccgcgttcgatcacctgatccgcaacagcgacgcagacgaagtg
gtcagcgaggcggaagctgaagcggcagtttga

DBGET integrated database retrieval system