KEGG   Paraburkholderia fungorum: OI25_8Help
Entry
OI25_8            CDS       T03799                                 

Gene name
sucA
Definition
(GenBank) oxoglutarate dehydrogenase (succinyl-transferring), E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bfn  Paraburkholderia fungorum
Pathway
bfn00020  Citrate cycle (TCA cycle)
bfn00310  Lysine degradation
bfn00380  Tryptophan metabolism
bfn01100  Metabolic pathways
bfn01110  Biosynthesis of secondary metabolites
bfn01120  Microbial metabolism in diverse environments
bfn01130  Biosynthesis of antibiotics
bfn01200  Carbon metabolism
Module
bfn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bfn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bfn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OI25_8 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    OI25_8 (sucA)
   00380 Tryptophan metabolism
    OI25_8 (sucA)
Enzymes [BR:bfn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     OI25_8 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AJZ60998
UniProt: A0A0D5VG00
LinkDB All DBs
Position
1:complement(8060..10921)
Genome map
AA seq 953 aa AA seqDB search
MMKQFQSNSYLFGGNAPYVEEMYEAYLDNPASVPENWRSYFDALQNVPASDGSNANDVAH
GPIVESFAQRAKANAFIPRTATGGEDLATSRKQVYVQSLIGAYRFLGSQWANLDPLKRRE
RPAIPELEPAFYDFTEADMDQEFSATNLYFGFERASLREIVKALRDTYCGTIGAEYMYIS
DPEQKRWWKEKLESIRSTPNFSNEKKKHILNRLTAAEGLERFLHTKYVGQKRFSLEGGES
FIASMDEVVRHGGANGVQEIVIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAGD
VKYHKGFSSDVSTEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDDSGLQVLPVQI
HGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDSRSTLYCSDVVKM
IEAPVLHVNGDDPEAVVLATQLAIDFRMQFHKDVVVDIVCFRKLGHNEQDTPAVTQPLMY
KTIAKHPGTRALYAEKLVQQGVITAEEADEFVKAYRKAMDEGHHTVDPVLSNYKSKYAVD
WVPFLNRKWTDAADTAVPLAELKRLAERITTIPENFKVHPLVERVINDRRAMGRGEAKLD
WGMGEHLAFASLVASGYAVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNIAEG
QAKFTVIDSVLSEEAVLGFEYGYSTAEPNTFVAWEAQFGDFVNGAQVVIDQFISSGEVKW
GRVSGLTMLLPHGYEGQGPEHSSARIERFLQLCADHNMQVVQPTTPAQIFHLLRRQMIRL
FRKPLIVATPKSLLRHKEAVSDLSELAKGSFQPVLGEIDEAIDAKKVKRVVVCSGRVYYD
LLAHRRESKSNDVAIIRIEQLYPFAHKQFEAEMKKYDNATEVVWVQDEPQNQGPWFYIEH
HLKEGMKDGQKLAYSGRPASASPAVGYYAKHYEQQKALVEGAFGRLKSASIAR
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcaattccagtcgaactcttatctgttcggcggcaatgctccgtacgtagaa
gaaatgtacgaagcgtatctcgataatccggcgtcagtgcccgagaactggcgcagctat
ttcgatgcgttgcagaacgttcctgcatcggatggcagcaatgccaacgacgtggcccat
ggcccgatcgtcgaatcgtttgcacaacgggccaaggcgaatgcctttatcccgcgcacg
gcaactggcggcgaagacctcgctacctcccgcaagcaagtctatgtgcagtccctcatc
ggcgcatatcgcttcctcggctcgcaatgggccaatctcgatcccctgaagcgccgcgaa
cgtcccgctatccccgaacttgaacctgcattctacgacttcaccgaagccgacatggac
caggagttcagcgccacgaatctgtatttcggattcgagcgtgcttcgctgcgcgagatc
gtcaaggctctgcgtgacacgtattgcggcacgatcggcgccgagtacatgtacatcagc
gatccggaacagaagcgctggtggaaagagaagctcgagtcgatccgttcgacgccgaat
ttctccaatgaaaagaaaaagcacattctgaatcgcctgacggccgctgaaggcctcgag
cgcttcctgcacaccaagtacgtcggccagaaacgcttctcgctcgaaggcggcgaaagc
ttcatcgcctcgatggacgaagtcgtgcgtcacggcggcgccaacggcgtgcaggaaatc
gtcatcgggatggcccaccgtggtcgtctgaacgtgctggtcaatacgctcggcaagatg
cccgccgacctgttcgccgaattcgaaggcaagcacgtcgacgacctgccggccggcgac
gtgaagtaccacaagggcttctcgtcggacgtctcaaccgaaggcggcccggttcacctg
tcgctcgcgttcaacccgtcgcacctcgaaatcgtcaacccggtggtcgaaggttcggcc
aaggcgcgtatggatcgccgcggcgacgacagcggcctgcaagtgctgccggtgcagatc
cacggcgacgcggccttcgcgggccagggcgtcgtgatggaaacgctgaacctcgcgcaa
acgcgcggttacggcacgcacggcacgctgcacatcgtcatcaacaaccagatcggtttc
acgacgtcggacccgcgcgactcgcgctccacgttgtactgctcggacgtcgtcaagatg
atcgaggcgccggtgctgcacgtgaacggtgacgatccggaagcggtcgtgctggctacg
caactggctatcgacttccggatgcagttccacaaagacgttgtggtcgacatcgtctgc
ttccgcaagctgggtcacaacgagcaggacacgccggctgtcacgcagccgctgatgtac
aagaccatcgccaagcacccgggcacgcgcgcactgtacgctgaaaagctcgtacagcaa
ggcgtgatcaccgcggaagaagccgacgaattcgtcaaggcctaccgcaaggcgatggac
gaaggccatcacacggtcgatccggttctgtcgaattacaagagcaagtacgcggtggat
tgggttccgttcctgaaccgcaagtggaccgatgcagccgacacggccgtgccgctggct
gagttgaagcgcctcgccgaacgcatcaccacgatcccggaaaacttcaaggtgcacccg
ctcgtcgagcgcgtcatcaacgaccgtcgcgcgatgggtcgtggtgaagcgaagctcgac
tggggcatgggcgaacacctggcattcgcgtcgctggttgcatcgggctatgcagtgcgc
ctgaccggtcaggactcgggccgcggcacgttcacgcaccgtcacgcggtgctgcacgat
cagaaccgcgagcgctggaacgacggcacgtatgtgccgctgcagaacatcgccgaaggt
caggcgaagttcacggtgatcgactcggtgctgtcggaagaggcggtgctgggcttcgaa
tacggttactcgaccgctgaaccgaatacgttcgtcgcgtgggaagcgcagttcggcgac
ttcgtgaacggcgcgcaagtcgtgatcgaccagttcatctcgtcgggcgaagtgaagtgg
ggccgcgtgtcgggtctcacgatgctgctgccgcacggctacgaaggccagggtccggag
cactcgtcggcacgtatcgaacgtttcctgcaactgtgcgcggaccacaacatgcaagtg
gttcagccgaccacgccggcgcagattttccacctgttgcgccgtcagatgatccgcctg
ttcaggaagccgctgatcgtcgctacgccgaagtcgctgctgcgccacaaggaagccgtg
tcggatctgtcggaactggcaaagggttcgttccagccggtgctcggcgaaatcgacgaa
gctatcgacgcgaagaaggtcaagcgcgtcgtggtgtgctcgggtcgcgtgtactacgac
ctgctggcgcatcgtcgcgaatcgaagtcgaacgacgtcgcgatcatccgtatcgaacag
ctctatccgttcgcgcataagcagttcgaagcggaaatgaagaagtacgacaacgcgacc
gaagtggtgtgggtgcaggacgagccgcagaatcaaggcccgtggttctacatcgagcac
catctgaaggaaggcatgaaggacgggcagaagctggcatacagcggccgtccggcttcg
gcctcgccggcagtcggctactacgcgaagcactacgagcagcagaaggcgctggtcgaa
ggcgctttcggccgcctcaagagcgcgtcgatcgctagataa

DBGET integrated database retrieval system