KEGG   Branchiostoma floridae (Florida lancelet): 118403077
Entry
118403077         CDS       T01074                                 

Definition
(RefSeq) TGF-beta receptor type-2-like isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo04068  FoxO signaling pathway
bfo04144  Endocytosis
bfo04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    118403077
   04068 FoxO signaling pathway
    118403077
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    118403077
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bfo01001]
    118403077
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     118403077
Protein kinases [BR:bfo01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   118403077
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ecTbetaR2 Pkinase_fungal
Other DBs
NCBI-GeneID: 118403077
NCBI-ProteinID: XP_035657408
LinkDB
Position
16
AA seq 638 aa
MVSATLRRGWGLAASNRRRGCSIVGPTSSLLLTTLAIALALMSPARAATSCRACEGTTPV
CDDVTGRCDVRCDYVKVCEGEGDGCVASMYPVVDNQTAEMTYEVQTGCWPGFNFNNPQED
ECRADDTFPGMYTCLCGTDECNGEIIIPRAGVDRPSVPESGGDIPPDFLLDPNDSPSPPV
GSGGFPWDPMAGPGRDDPTVRPGGESNHHFVGSSATASADRAYGPDNTSVLIGIVTIIPA
ILVLVLVIFAAYVLYRRRHPKTPPSSIFGTKLEDGNGNYQIKLDDFDSEVADPSLENTLN
HNEEHLPIKLDTSVGKGRFAEVWKGKLFQESEDRFVTVAVKIFRYDEKQSWQREKDIFSD
PALKHPNILDFLTAEERGSGIDRQYWLITSYHSNGCLRAYLGRHVLSWEQLIVMSQTTAA
GLAYLHADRATDGAAKMPIAHRDVKSSNVLVKSDGTCCLADFGLALNLDPTIRVEEYANS
GQVGTPRYMAPEALESRVNLVNLESFKQIDVYAMALVLWEMLARCEVTGDVAPYQPAYAD
KLSGDHPGIDTMKDVVIRGRERPDIPPGWLVHQGLCRMSEIIEDCWDHDGEARITASCAE
ERINELQKRQFTAITIDSEDDEKEPLRPKTRYIEETDV
NT seq 1917 nt   +upstreamnt  +downstreamnt
atggtttccgcgactttgcgtcggggttggggactggcggcgtcgaaccggcgtcgcggc
tgttcaatcgtcggaccgacttccagtcttctgttgaccaccttagcaatcgcgcttgct
ctgatgtcgcccgcccgggccgccacgtcgtgccgcgcctgcgagggaacgacgcccgtg
tgcgatgacgtcacgggacgttgtgacgtcaggtgcgactacgtcaaggtgtgcgagggg
gagggcgatggctgcgtcgcgtccatgtaccctgtggtggacaaccagacggcagagatg
acgtatgaagtgcagacgggatgctggcccggcttcaacttcaacaaccctcaggaggac
gaatgcagggcagatgatacatttccggggatgtacacttgtctgtgcgggacggacgag
tgtaacggagagatcatcatcccccgtgcaggagtggaccgtccctcggtcccggagtcg
ggaggagacatccccccggacttcctactggatccaaatgactctccgtctccccccgtg
gggtcgggcggtttcccctgggatcccatggcagggcctggacgggacgatcccactgtc
cgtccagggggtgagtccaaccatcacttcgtgggtagctctgccactgctagtgctgac
agagcctatggaccagacaacaccagtgtcctcatcggtatcgtcaccatcatccccgcc
atcctggtcctggtccttgtcatctttgccgcgtacgttctctaccgccggagacacccg
aagaccccgccttcgtcaatcttcggcaccaagctcgaggacggcaacggaaactaccaa
ataaagctcgacgacttcgactcggaggtggccgacccgagcttggaaaacactctgaat
cacaacgaggaacacttacccatcaaactggacacctcggtcgggaagggacgcttcgca
gaagtctggaagggaaaactgtttcaagagagcgaggacagattcgttactgtcgccgtt
aagatcttccgctacgatgagaagcaatcttggcaacgtgagaaggacatcttctcagac
ccagccttgaagcaccccaacatcttagactttctgacagctgaggagcggggtagtggc
atcgataggcagtactggctcatcactagttaccatagtaacggctgtctgagggcgtac
ctcggacgtcacgtgctgtcgtgggaacagctgattgtgatgagtcagacgacagcggca
gggctggcctatctgcacgcagacagagccacggacggagcggccaagatgccgatcgct
cacagggatgtgaagagctcgaatgtgctggtgaagagtgacggaacctgctgcctggct
gactttgggctggctctcaacttggaccccacaataagggtggaagagtacgctaacagt
ggccaggtgggcacacctaggtacatggcccctgaggcgctggagtcccgtgtgaacctg
gtaaacctggagtccttcaaacagattgacgtgtacgccatggcactggtactgtgggag
atgctcgccaggtgtgaggtcactggagatgtggccccctaccaacccgcgtacgctgac
aagctgagcggcgaccaccccgggatcgacaccatgaaagacgtggtgatccgtggacga
gagaggcctgacatcccacctggttggctggtacatcaggggctgtgccgaatgtcagag
atcatcgaggactgttgggaccacgatggcgaggctcgcatcaccgcgtcgtgcgcagag
gagagaataaacgaactacagaagcgccagttcaccgccatcactatagactcagaagat
gacgaaaaagaacccttaagaccaaaaaccagatatattgaagaaacagatgtataa

DBGET integrated database retrieval system