KEGG   Branchiostoma floridae (Florida lancelet): 118404575
Entry
118404575         CDS       T01074                                 

Definition
(RefSeq) adenylate cyclase type 3-like
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00230  Purine metabolism
bfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    118404575
Enzymes [BR:bfo01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     118404575
SSDB
Motif
Pfam: Guanylate_cyc AC_N CitMHS HNOBA
Other DBs
NCBI-GeneID: 118404575
NCBI-ProteinID: XP_035659644
LinkDB
Position
17
AA seq 1061 aa
MTDITVIESTDGGFDNVNPASSNNISDRASTGTSGNKSRSWASIVRRKFTVSLGSPRLET
VYRGYFRRQKRGCLLCVLLIAILYELRILVMDCVSFTVDRVPTIVLSAVLLCVHAVLFAL
CKAGKCSKKFEERVLPYLVWALLTAQALTYSGLQRQRLTPTHSLEWQLFLVFVVLTCLPL
SLLSLLLLTGATALGHAVLCGAMAQAQTEFLGLQLISNGLLYACAVTLGVIFYLLVDRKY
RKSFLDTRSSLEVKVHLQEQTQHQEQLLMSILPRHVAEDMRRGMSRKDTEDRQFQQMYIK
RHENVSILFADIVGFTAISTTVSAQELVKILNELFASFDKLADINNQLRIKILGDCYYCI
CGVPVPRKDHAVCSINMGLDMVDAIAQVREKTRSPVDMRVGIHTGAVLAGVLGQKRWQFD
VWSTDVTLANQMESGGMPGRVHISKATHDCLNGEFELEQGNGASRNDYLKSRGIKTFLIK
RRTEKRELAASFPKKSAWSSIMIKNGGVKKVDDGKKPTARLCFQRLAIRALRNEQEINNL
VRKTLEEQDYKAIDGKVNPVTLRFKDADLEMKFGKEREKQCAVCLVAFAVILVFCFLVQI
TVIARTIMAVIAFVICLVGIVSMVIVTSATIFHTNFPAMLVRVSNWLDGNRYIRNTWTLV
AVTMVIAGILINTLSCDVTGPVLFSPPLDRLDLSCPYTQYFVFAIVLMLSGLTMQMHISH
VTKFLTMCVITTVTCLVSFVLENGGLGISRSVNQNFTGNSTDSPDPVPPAAQLCVSLSVI
TICLLLICRQMESATRLLFLWKMETTKQREEVGQIRKQNEDLVNNILPPHVSTHFIGVKR
KDEELYSQSYEEVGVLFASIPNFSDFYTEESVNNSGIECLRFLNEIIYDFDALLSKPKFR
SITKIKTIGSCYMAASGLNPDDNMAHSPDRLVRLKHLADLADFALALKEALMNINYQSFN
NFLLRIGIHQGSVVAGVIGARKPHYDIWGNTVNVASRMESTGQPGQIQVVEETSHLLKEF
GFKLEQRGVVKVKGKGELMTYFLKGREKPEVSNISLPNVVG
NT seq 3186 nt   +upstreamnt  +downstreamnt
atgaccgatataactgttatagaatctacggatggaggctttgacaatgtcaacccggcc
tccagtaacaacatctcagatagagcctccaccgggacatcggggaacaagtctcggtca
tgggcgagcatcgtgcggaggaagttcactgtatccctcggctcccctcgactcgagacg
gtctaccgtggctacttccgtagacagaaacgcggatgtctcctctgcgtgctcttgatc
gccatcttgtacgagttaaggattctggtcatggactgcgtgtcgttcaccgtggataga
gtgccgactatcgtgctgtccgcggtgctgctgtgtgttcacgccgtgctgttcgcgcta
tgcaaggccgggaagtgttcgaaaaagttcgaggagagggtgctgccgtacctggtgtgg
gcgctgcttactgcgcaggcgctgacttacagtgggctccagaggcagagactgacgccg
acacactcattggagtggcagctgttcctagtattcgtggtgctgacgtgcctgccgctc
agcctgctgtccctgctgttactcacgggtgccacggcgctgggtcacgctgtgctgtgc
ggcgccatggcgcaggcgcagacagagttcctcgggctacagcttatcagcaacggcctt
ctctacgcatgcgccgtgaccctgggggtcatcttctacctgttggtggaccggaagtac
cggaagtcgtttctggacaccaggtcgtccctggaggtcaaagttcatctgcaggaacag
actcaacatcaggagcagctgctgatgtccatcctgccgcgtcacgtggcggaggacatg
cggaggggcatgagcaggaaggacacagaggacaggcagttccaacagatgtacatcaaa
cggcacgaaaacgtcagcatcctgtttgctgacatcgtgggcttcacggcgatctccacc
accgtgtctgctcaagaactggtcaagattctcaacgagctcttcgccagcttcgacaaa
ctcgccgatatcaacaaccagttgcgtattaagatcctgggcgactgttactactgcatc
tgtggtgtacctgtgccgagaaaggaccacgctgtttgctccatcaacatggggctggat
atggtagacgccatcgcgcaagtgcgagaaaagacgagatctccggtggacatgcgcgtt
gggatccacacgggcgcggttctggcgggggtgctgggccagaagcggtggcagttcgac
gtctggtcgacagatgtcactcttgcaaaccagatggagtccggagggatgcctgggaga
gttcacatctccaaggccacgcacgactgtctgaatggagagtttgaactggagcagggg
aacggggcttcccggaacgactacctcaagtcacgtggtatcaagacattcctcatcaaa
cggagaacagagaaaagggagttggcggcttctttcccgaagaagtccgcctggagtagc
ataatgataaaaaatggcggcgtcaagaaagtggacgatggaaagaagccaacagcgagg
ctgtgcttccaacgtctggccattcgggcactccgaaacgagcaagagatcaacaacctg
gtcagaaaaacactggaggagcaggattataaagcgattgacggcaaggtcaaccccgtg
accttgagattcaaggacgctgaccttgagatgaagttcgggaaggaacgagagaagcag
tgcgcggtctgcctggtcgccttcgctgtgatcctggtgttctgcttcctggtccagatc
acagttattgcgcggaccattatggcggttatcgccttcgtcatctgtctggtgggtatc
gtttccatggtgatcgtgacgtcagccactattttccacacgaactttcctgcgatgttg
gtgagggtgtccaactggctagacggaaacaggtacatccggaacacctggacactggta
gctgttaccatggtgatcgccgggatactcatcaacacgctatcctgtgatgtgacagga
cctgtgctgttctccccgcccctggacagactggacctcagctgtccctacacacagtac
tttgtcttcgcaatagtcctcatgctgtctggactcactatgcagatgcacatcagtcac
gtgaccaagtttctgacgatgtgcgtcatcaccactgtcacgtgccttgtcagtttcgtt
ctggaaaatggcggactcggaatatcaagaagtgtcaatcagaacttcacgggaaactca
acggacagcccggatcctgttccgcctgcagcgcagctctgcgtcagtctgtccgtcatc
accatctgtctcctactcatctgcagacagatggaaagtgcgacacggcttctcttcctg
tggaagatggagaccactaagcagcgtgaagaggtcgggcagatcaggaaacaaaacgag
gatcttgtgaacaacatcctccctccccacgtgtcaacgcacttcatcggggtcaagcgg
aaggacgaggagttatatagccagtcctatgaggaagttggcgtcctgttcgcgtccatc
ccgaacttctccgacttctacacggaggagagcgtgaacaactccggcattgagtgtctc
agattcctcaacgagatcatctacgactttgatgcgctcctgagtaaaccgaagttccgc
agcatcactaagatcaaaaccatcggcagctgctacatggccgcctcgggactcaaccct
gacgacaacatggcgcatagccctgaccgactggtgagactgaaacacctagcggatctg
gccgactttgcactcgctctaaaggaggccctgatgaacatcaactaccagtccttcaac
aacttcctcttgagaataggtatccaccaaggctctgttgtggcgggggtcatcggcgcc
aggaagcctcactatgacatctgggggaacaccgttaacgtggcgagtcggatggagagt
acggggcaacctgggcagatacaggttgttgaagaaacgagccacctactcaaggagttc
ggtttcaaattagaacagcgaggagtagtcaaggtcaaggggaaaggtgaactgatgacg
tacttcctgaaggggcgggagaaaccggaagtcagcaacatcagccttcccaacgtcgtt
ggctga

DBGET integrated database retrieval system