KEGG   Branchiostoma floridae (Florida lancelet): 118406300
Entry
118406300         CDS       T01074                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    118406300
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 118406300
NCBI-ProteinID: XP_035662126
LinkDB
Position
19
AA seq 230 aa
MSTARVSCPSPELRRARPARPAGMPRSSACRRLFGPVDHEELERDLRSQLAKIEEDSQRK
WNFDFKSDCPLEGRYEWERVSGVPSFYIGRVNISVSPAAAASHAPEQLACTARSTTEDSP
GLVGETAVRTVAKNSACTEEHRESRVDARVEDLSAEISSTVSAGSERPGPGASGNTPGST
PTMSRGVKRQTRLTDFHVQRKRKRRQQQAVASKENQQTRSEPLASRPAVV
NT seq 693 nt   +upstreamnt  +downstreamnt
atgagcaccgccagagtgtcgtgtccgtccccggagctgagaagagctcggcccgcccgg
ccggctggaatgcctcgcagctcggcttgcaggcgactgttcgggccggtggaccacgaa
gagctggaacgagaccttcggtcgcagctagcaaagatagaagaggactcccaacgcaaa
tggaactttgacttcaaatctgactgtcccttggagggcagatacgagtgggagagagtc
agcggcgtaccgtcgttctacatcgggcgggtcaacatctcagtttctccagcggcggcc
gcttcgcacgcccccgagcagctggcctgcacggcacggtctactacggaagattccccg
ggactggtcggagaaacggccgtaagaactgttgcaaagaactctgcgtgtaccgaggaa
cacagggaatccagagtagacgcgagagtagaggatttgagtgcagaaatcagctcgact
gtctccgctggttcggagagaccaggtccgggtgcctcggggaatacacccggctctacc
ccgaccatgtccaggggtgtcaagcgtcaaacgagactcacagatttccacgtacaaagg
aagagaaagagaagacagcagcaagcagtggccagcaaagaaaatcagcagacaagatct
gaacctctcgcatcgcgtcctgcagtagtttga

DBGET integrated database retrieval system