KEGG   Branchiostoma floridae (Florida lancelet): 118416734
Entry
118416734         CDS       T01074                                 

Definition
(RefSeq) pro-neuregulin-4, membrane-bound isoform-like
  KO
K08774  transforming growth factor, alpha
Organism
bfo  Branchiostoma floridae (Florida lancelet)
SSDB
Motif
Pfam: Adeno_E3_CR2 EGF EGF_2 Phage_holin_2_1 FeoB_associated
Other DBs
NCBI-GeneID: 118416734
NCBI-ProteinID: XP_035677848
LinkDB
Position
5
AA seq 148 aa
MVTTTVPEKHLRLMILTLCLVPAFSQDGIFYDDCPESYSGYCLNGGTCTILPGLPEDQAI
RCSCPSDKVGERCENSNPNSQTTARGPEGEIRAVYIVVGVLGGLLLIATVATVVYFCRRN
KHEGECEGEQKLNGGEMSSTSKVITTIV
NT seq 447 nt   +upstreamnt  +downstreamnt
atggtgacgacgacagttcctgagaagcacctgaggttgatgatactgactctgtgttta
gtaccagcgttttcacaagatggaattttctacgatgactgccctgagagttacagcggt
tattgcctgaacggggggacgtgtaccatattacctgggctgccggaggatcaagcgatc
agatgcagttgcccatctgacaaagtaggagagcgatgtgagaacagcaaccctaattct
caaactacagcgagagggcctgaaggcgagatccgagctgtgtacatcgttgtgggcgtt
cttgggggactcctgctcatagccacagttgccacagtggtctacttctgcagacgaaac
aagcatgaaggcgaatgtgaaggagaacagaaacttaatggcggcgagatgtcctcaacg
agcaaagtcatcactacaatagtatag

DBGET integrated database retrieval system