KEGG   Branchiostoma floridae (Florida lancelet): 118420980
Entry
118420980         CDS       T01074                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta-like isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    118420980
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bfo03000]
    118420980
Transcription factors [BR:bfo03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    118420980
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DivIC ZapB KASH_CCD GIT_CC
Other DBs
NCBI-GeneID: 118420980
NCBI-ProteinID: XP_035683982
LinkDB
Position
8
AA seq 670 aa
MALDFISEADSRFFADNLLSSEDWDDGTLCNIEDLPDISDFGSADDLLQRIPDIEFDDLL
GGRSDLLDGRTDLKLSDGFNDPWPDMDVGLDQNGFQDIQVKTEPLSPAPSSCSDSSGEGF
SNQKYFDNPQMSPQNGIVEVKLETPPLTPGSQNPSPPPPMSPYQCKPTPIVPKPAGVPII
TAQPTGAQTQPSLQDTLQNLKAQTPGQPIVLTQAEFARLAAQGLIKPTNQQAVTTTTTQQ
PAATLTNQQPAPAPVQVPPAKPIAPAMSNASLANGNVDMKVLKRQQRMIKNRESACLSRK
KKKEYLQGLEDKLKALGRQNEKLRQENTLLKKRVDFLNNENERLRSSKSLFGSKQTTVAM
AILFLVCFNLAPLATYSLFRRTSDPEIGDMPIRHARTLLQFSEDGNMYSQDPDQTNDFRY
SAPQEDVVPGNESKPGKEKSRSSSLSDKALMILPEFPKPGGSKPGIEERVLPSCPLFNTT
DSIRLADELTGWLAGLHKQEFKEKQKTKKKPPPKKKRPAVHRSPKRYQNTHLALAPHPDN
EVYEVQVFGGPDRSYLEFLEAINRREDTFYVVSFRKDHLLLPATAHNKTMRPRMSLLMPA
VNETLLDTPQGHMAMMQIDCEVMNTQMIQLKTSNIPAYLRDNATYAVPSQNMDPKTVHVH
PHPEGTIPPH
NT seq 2013 nt   +upstreamnt  +downstreamnt
atggcgttggacttcatttcagaggcggactcgcgattcttcgccgacaacttgctgtcc
agcgaggactgggatgatggcacactgtgtaacattgaggacctgcccgacatcagtgac
ttcggcagtgcagacgatctcttacagaggatacctgacatagagtttgatgacttgctg
gggggcaggtctgacctgttggacggcaggacggacctcaagctgtctgatgggttcaat
gacccctggcctgacatggacgtcggcctcgaccaaaatggtttccaagatatccaggtg
aagacggagcccctgtctcccgccccctcctcctgctccgactcctcaggggagggattc
tcaaaccagaagtattttgacaacccccagatgtccccccagaacggcatcgtggaggtg
aagctggaaacccctcccctgacccccgggtcccagaacccttctcccccaccccccatg
tccccctaccagtgtaaacccacccccatcgtgcccaaacccgcaggggtgcccatcatc
actgcacagcccacaggtgcacagacacagcccagtctacaggacacactacagaacctc
aaagcacagactccaggtcaacccatagtcctgacacaggcagagtttgccagacttgca
gcacaggggctcatcaagccaaccaatcagcaggctgttaccacgacaacgacccagcaa
cctgcagccacgctgaccaatcagcagccagccccagctccagtccaggtgccccctgcc
aagcctattgcacctgccatgtccaacgcctcactggccaatggcaatgtagatatgaaa
gtgctgaagcgccagcagcggatgattaagaaccgagagtcggcctgtctgtccaggaag
aagaagaaggaatatctgcagggtcttgaagacaaactcaaggctctcggacgacagaac
gagaaactgcgccaggaaaacactttactgaagaagagagtagactttcttaacaatgag
aatgagagactacggagttcaaagtcactctttggcagcaaacagaccactgttgccatg
gcaatactgttcctggtctgcttcaatctggcacctttagctacatacagtttgttcaga
agaacatcagacccagagataggagacatgcccatcagacatgcgcggacactcctgcag
ttctcagaagacggtaacatgtactcccaggaccctgaccagactaacgacttcaggtac
agtgctccccaggaggatgtggttcctgggaatgagagcaaacctgggaaggagaagagc
aggagcagcagcttgagtgacaaggccctgatgattctcccagaattccccaaacctgga
gggagtaaacctggcatagaggagagagttctgccgtcatgtccactcttcaacaccaca
gactctatcaggttggcagacgagctgaccggctggctggcaggcctgcacaaacaggag
ttcaaggagaagcagaaaaccaagaagaagcctcctcccaagaagaagaggcctgcagtc
cacaggtcccccaagcggtaccagaacacccacctggccctggccccccaccctgataac
gaggtgtacgaggtccaggtgtttggcgggcccgaccgcagctacctggagtttctggag
gccatcaacaggagggaggacaccttctacgtcgtctccttcaggaaggaccacctcctg
ctgccagccactgctcacaacaagaccatgaggccacgcatgtccctcctcatgcctgct
gtcaatgaaaccctgctggacactccccagggccacatggccatgatgcagattgactgt
gaggtgatgaacacccagatgatccagctgaagacatccaacatccccgcctatctccgt
gacaacgccacctacgccgtcccctcacagaacatggaccccaagactgtccatgtgcat
cctcacccagaaggcaccattcctcctcactag

DBGET integrated database retrieval system