KEGG   Branchiostoma floridae (Florida lancelet): 118423605
Entry
118423605         CDS       T01074                                 

Definition
(RefSeq) transcription factor p65-like isoform X1
  KO
K04735  transcription factor p65
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    118423605
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bfo03000]
    118423605
Transcription factors [BR:bfo03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    118423605
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 118423605
NCBI-ProteinID: XP_035687727
LinkDB
Position
1
AA seq 768 aa
MAETSDPSLLDDVCPSMPLETMLKLLDQPGPQSPMDETQRAVMEVLDRDNTAVMEVLNRD
PTERAAPVVVNGDPDTSMVGVLNSDDQVAVMDVLNRDPYAGEVTFVQETKTNIPPPGEPN
KIVYVGTVDSVNNESITISGSQLPMDWDTFQELEEIIKKDAMLSSTTVKQEQPEHRELAA
CRFQAVKEKKPPVIEIIEQPKARSLRFRYECEGRSAGSILGENSSPENRTYPTIRLLNCS
GPAMILVSLVTKDDPPKPHPHSLVGKGCIHGICKINVPDCGAPISFPNLGIQCVKRKEIT
QALAQRIRLGIDPFHTYSRHKGKMDEVDLNTVRLCFQAFLPHPQTGQCTVPVPPRVSMPI
HDKKAPGAAELRICKMNKVSGPVTGGDEVTLLCDKVQRDDIEVVFTAKPMGIKWESRGDF
SPTEVHRQVAIVFKAPAYFNLTIKEPVRVQVRLRRPSDGEESEPFDWTYTPVDKDEHSVE
SKRRKKMPDFAKFLNVPPCSGAAAGPPHTHRMARSNMRGIPMETLQTRPSPAAAAASLPV
SEDVRQLLRRKVQGQGGSQQLFMPPMQTGQFKQDPDLAFVPSSQPPTQPVLAAAGSGAAA
MRAAPPVYPPSSQPAYPPQLSGVTLSGLMQATKSNIPQASRVDPTGVVYNPSTFISRGGR
KSAKTAASAAKPKPPPTTTSSASGDKNSFTTTDLSSLGLTFTQVQVQKPDPQAGAQAEVY
LEPYQGGDELLNSIDISSLELGSEVTIDANTHADLNELLELVKQNKEE
NT seq 2307 nt   +upstreamnt  +downstreamnt
atggctgaaacctcagatcccagcctgctggatgatgtttgtcccagcatgccactggag
accatgctgaaactgttagaccagcccggaccacagagtcccatggatgaaacacaaaga
gctgttatggaagttctggacagagacaatactgctgtcatggaagtgttaaatagggac
cctacagagagggcagctcctgtagttgttaatggagatccggacacttccatggtgggg
gttctcaacagtgatgatcaagtagcagtgatggacgtgttaaacagggacccgtatgca
ggggaggtaacttttgtacaagagacaaaaacaaacattcctcctccaggagaaccaaac
aaaattgtttatgtgggaactgtggactctgtgaacaatgagtctatcaccatcagtggg
tcacagctgcccatggattgggacacatttcaagaacttgaggaaatcatcaagaaagat
gcgatgctgtcatccacaactgtgaagcaggagcagccggagcacagggaactggcagca
tgtaggttccaggcagtaaaagagaagaaaccaccggttattgagatcattgagcaaccc
aaggcacggagcctgcggtttcgctacgagtgtgaggggcggtcagcaggcagcatcctg
ggagagaactcctcacctgaaaacagaacgtacccaaccatacggctgctaaactgcagc
ggtcctgccatgatcctggtttccttggtaaccaaggatgacccacccaagccccaccct
cacagccttgtgggtaaaggatgtatccatggcatctgtaaaatcaacgtaccagactgt
ggggcaccaatcagcttccctaacctggggatccagtgtgtgaagaggaaggagatcacc
caggctctggcccagagaatacggctggggatcgaccccttccacacctacagcagacac
aaggggaagatggacgaggtggacctgaacacggtccggctgtgtttccaggccttcctg
ccccaccctcagactggacagtgcaccgtgccggtcccccccagggtgtccatgcccatc
catgataagaaggcacccggagcagctgagctgagaatatgtaagatgaacaaagtgtct
ggccctgtgactggaggggacgaggtgacactgctgtgtgacaaggtccagagagatgac
attgaagtggtcttcacagccaagcccatgggaatcaagtgggagtccaggggagacttc
tcacctactgaggtacacagacaggttgccattgttttcaaggctcctgcatactttaac
ctgaccataaaggagccagtcagagtccaggtgcggctgaggcgcccgtccgatggggag
gaaagtgagccatttgactggacgtacactccagtggacaaagatgaacacagtgttgag
tcaaagagacgtaagaagatgccagactttgccaagttcctgaacgtccctccctgcagt
ggggcagcagcagggccacctcatacacaccggatggcaaggtccaacatgagaggcatt
cccatggagacactacagacacgcccatccccagcagctgcagcagcatcgctgcctgtg
tccgaggatgtccgacagctgttgcgcaggaaagtccaaggtcaaggaggatcacagcag
ctgttcatgcctcccatgcaaacaggacagttcaagcaagatccagacctggcttttgtc
ccctcgagtcagcctcccacccagcctgtcctggctgctgcaggctccggtgccgctgcc
atgagagctgctccaccagtctacccaccatcttctcagccagcctaccctccccagctc
tcaggagtcaccctcagtgggctgatgcaggccaccaagtccaacatcccccaggcctcc
agggtggaccctacaggtgtcgtctacaacccctcaaccttcatcagcaggggtgggcgg
aagtctgccaaaactgcagcgtctgcggctaaaccaaagccaccaccgaccacgacttcc
tctgcctcaggggacaagaacagcttcacaacaacagacctgtcatcactgggactgact
ttcacacaggtacaggtacagaaaccagacccacaggcaggggcgcaggctgaggtttac
ctggaaccgtaccagggtggggatgagctgttaaactccatagatatcagctccctggag
ctggggtcggaggtcaccattgatgccaacactcatgctgaccttaatgagttactggag
ttggtcaaacagaacaaggaggagtga

DBGET integrated database retrieval system