KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_103036Help
Entry
BRAFLDRAFT_103036 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K02358  elongation factor Tu
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bfo03012]
    BRAFLDRAFT_103036
   03029 Mitochondrial biogenesis [BR:bfo03029]
    BRAFLDRAFT_103036
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bfo04147]
    BRAFLDRAFT_103036
Translation factors [BR:bfo03012]
 Eukaryotic Type
  Elongation factors
   BRAFLDRAFT_103036
 Prokaryotic Type
   BRAFLDRAFT_103036
Mitochondrial biogenesis [BR:bfo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BRAFLDRAFT_103036
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BRAFLDRAFT_103036
  Exosomal proteins of breast cancer cells
   BRAFLDRAFT_103036
  Exosomal proteins of colorectal cancer cells
   BRAFLDRAFT_103036
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-GeneID: 7208613
NCBI-ProteinID: XP_002611814
JGI: 103036
UniProt: C3XVN0
LinkDB All DBs
AA seq 408 aa AA seqDB search
MAAEAKKFVRDKPHLNIGTIGHVDHGKTTLTAAITKVLSAQGGAEYRKYDEIDRAPEEKA
RGITINQTHVEYTTDNRHYGHVDCPGHADYIKNMITGTAQMDGAILVVAATDGCMPQTRE
HLLLAKQIGISHIVVYVNKADVVDSDTLELVEMEMRELLTEFGYPGDDVPLIVGSALYAL
EGKDSELGEASIHKLLEAVDSYLPLPQRDLDKPFMMPVEMVHSISGRGTVVTGTMIRGTI
HKGDPALIIGYGVNVKTVITGIEMFHQQLDRAEAGDSLGALVRGVKKGDVRRGTMLCKPG
SVAPQEKVQAQVYILTKEEGGRRTPFTNTYTPVMFSHTWNMACRVSLPEGKEMVMPGEDT
TLSLVLRTPMVMEPGQRFTLRDGNHTIGTGVVTKILPPPKPEEKFTGN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagaggccaagaagtttgtccgagacaagcctcatctcaacatcggaaccatc
ggccacgtagatcatggcaagaccaccctgactgccgctattactaaagtgctgtctgcc
cagggcggagcggagtacaggaagtacgatgagatagaccgcgctcccgaggagaaggca
cgcggcatcaccattaaccagacccacgtggagtacaccacggataaccggcactacgga
catgtggactgtcctgggcacgctgattatatcaagaacatgatcacaggtacagcacag
atggacggagccatcctggtggtggctgctacagacgggtgcatgcctcagacaagggaa
cacttactactagctaaacagattggtatctcccacatcgttgtttacgtaaacaaggcg
gatgttgttgacagcgacaccctggagctggtggagatggagatgagggagctgctgaca
gagtttggttaccccggtgatgacgttcccctgatcgtcgggtctgctctgtacgctctc
gagggtaaggactcagaactaggagaggcgtccatccataaactgctagaagcagtggac
agctacctgcccctcccccaacgtgatctggacaagcccttcatgatgccagtggagatg
gtacactccatctcaggccgtggtacagttgtgacgggtacgatgatccgtggaaccatc
cacaaaggagaccccgccctcatcattggatatggtgtcaatgtaaagactgtgatcaca
ggtattgaaatgttccaccagcagctggacagggcagaggcaggggacagtctgggtgca
ctggtcaggggtgtaaagaagggtgacgtgcgcaggggaaccatgctgtgtaaacctggg
tcggtcgcaccacaggagaaggttcaggctcaggtttacatcctgactaaagaggaaggc
ggccgtcgcacaccgttcaccaacacctacactcccgtcatgttctcccacacgtggaac
atggcgtgtcgagtctccctgcccgagggaaaggaaatggtgatgcccggagaggacacc
accctgtccctggtgctgagaacccccatggtgatggagccgggacagagattcacgtta
cgcgacgggaaccacaccatcggcaccggggtcgtcaccaagatcctgccgcctccaaaa
ccagaagagaaattcacggggaactaa

DBGET integrated database retrieval system