KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_103129Help
Entry
BRAFLDRAFT_103129 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bfo03036]
    BRAFLDRAFT_103129
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     BRAFLDRAFT_103129
Chromosome and associated proteins [BR:bfo03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     BRAFLDRAFT_103129
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln DUF572
Motif
Other DBs
NCBI-GeneID: 7208855
NCBI-ProteinID: XP_002596886
JGI: 103129
UniProt: C3Z354
LinkDB All DBs
AA seq 926 aa AA seqDB search
MVIDGREQQGSAGGEVEDRLNYIKQQQALQRELLHQHFRQQEEQLARQHQAELQQHLHLQ
KLQALREQQELAQARGKLQEKQSERQKQLLAGKKKENSAMASTEVKEKLQTFILSKKQRE
AAANSLHQSPSLSMAHWPHGSLGHMPMSGDLAAAAAYKGHPMLGTYGSNADFPLRKTASE
PNLKVRSRLKQKVAERRSSPLLRRRDGIGGSFKTRKPLSNKIHIQVPQSAPGSGPSSPRS
SHSNMVIAGNHEESGVQPAVVPGRMVGGNAADFTLYTSPSLPNISLGLANSSSSAETTQT
GEKVVQSALSREAELRAMAAARLGQPLTVVPAREPQPAPRSDEGLGTAGHSPSNCAASAS
RPLGRTHSAPLPGTHMHHLQQQVLHPQHYMQALLRQHVVNKQQLGNGDIAKQPRPEPHPE
ETEEELKEHTQVTVKQEPLDSDEENEEEESCRQLDMNIDGTSTHRPLSRAQSSPATYNSV
KSVFTTGVVYDPLMLKHSCSCGNNSYHPEHSGRIQSVWSRLQETGLVNRCERVRSRKATI
DELKTCHSEQHVYLYGTNPLHRQKQDSKKLAGGLQKSFKYLPCGGLGVDADTIWNELHSP
SALRMAAGCVIELAFKVAQGELKNGFAVVRPPGHHAEVDQAMGFCFFNSIAVTARLLVQR
LKLNKVLIVDWDVHHGNGTQQMFYEDGQVLYVSLHRWDSGNFFPGTGAPDECGNGAGLGK
NVNISFSGGLEPPMGDAEYMAAFRTVVMPIAVEFSPDLVLVSAGFDTAEGHAPQLGGYKV
TPKCFGHMTKQLMSVAGGRVVLALEGGYDLAAICDCSEMCVQALLGDELPPLPKEIIEQP
PNKNAVTSLEETIRRQTPHWSSLSRYASTVGYSLYEAYEREKEEADTVSALASLSVASAP
GVGMPASANSERNHKPQPLEDTINGL
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atggtaatcgacgggcgcgagcagcagggtagcgcgggaggcgaggttgaagaccgtttg
aactacatcaagcagcaacaggctctacagcgagagctcctgcaccagcacttcagacaa
caggaggagcagctcgcccggcaacatcaggcggaactgcagcaacacctgcacctacag
aagctgcaggccttgagagagcaacaggagctggcacaggccaggggaaaactccaggaa
aaacagtcggagcgacaaaaacaactcctggccgggaagaaaaaagaaaacagtgcaatg
gcctctacagaggtgaaggagaagttgcagacgttcatcctgagtaagaaacagcgagag
gcggctgctaacagcctccaccagtctccatccctcagtatggctcactggccccacggc
tctctgggtcatatgcccatgtcaggtgacctggcggcggcggcggcgtacaagggacac
ccgatgttgggtacttacgggagcaacgcggacttcccactcagaaaaacagcctccgag
ccgaatctgaaggttcgatcgcgcttgaaacagaaggtagcggagcgaagaagcagtccg
cttttacgcaggcgtgacggcataggaggcagctttaagacaagaaaaccgttatcaaat
aaaattcatatacaggtcccacagagcgccccggggtcgggacccagctcccccaggagc
agccacagcaacatggtcatcgctggcaaccacgaggaatccggtgtccagcctgcagtg
gtgccggggagaatggtgggcgggaatgcggcagacttcaccctgtacacctccccatct
ctacccaacatctccctcggactggccaactcttcaagttctgctgaaaccactcagacg
ggagagaaagtcgtgcagtcggcgctatcccgtgaggcggagcttcgcgccatggcggcg
gcacggctcggacagccgctgaccgtcgttcccgcccgggaaccccaacctgctccacgc
tcggatgaaggccttggaacagcagggcattcccccagtaactgtgcagcatctgctagc
agacctctgggtcggacccactcagcgcccctccccggtacacacatgcaccacctacag
cagcaggtgctccacccgcagcactacatgcaggcgctgctcagacagcatgttgtaaac
aagcagcagcttggtaacggggacatcgctaagcagccccgcccggagccccaccctgag
gagacggaggaggagctaaaggaacacacgcaggtcaccgtcaaacaggagccgctcgac
agcgacgaggaaaacgaggaggaggaatcctgtcggcagttagatatgaatattgacggg
actagcactcacagaccactatccagagctcagtcatcgccggcgacatacaactctgtc
aaatctgtctttaccacaggagttgtgtacgaccccctgatgctgaagcactcgtgcagc
tgtggtaacaacagttaccatccggaacactccggtcgcatccagagtgtctggtccaga
ctacaggagaccgggctagtcaacagatgtgagagagtacgatcaagaaaagctacaata
gatgagttaaaaacctgtcatagtgagcagcatgtgtatttatacgggaccaatccacta
catcggcagaaacaagacagcaagaaactggctggaggtctgcaaaagagtttcaagtat
cttccatgtggaggactgggggttgacgctgacacgatctggaatgagctacactcaccc
agcgcccttcgtatggcggcaggctgtgtcatagaactggctttcaaggtcgcacaggga
gagctcaagaatggcttcgctgttgtcagacccccaggacatcatgctgaggttgaccag
gccatgggattctgtttcttcaactcaattgcagtcacagcaaggcttttagtacagaga
ttgaagttgaacaaagtgctaatagttgactgggacgtgcatcatgggaacggcacacag
cagatgttttacgaggacgggcaggtgttgtacgtctccctgcaccgctgggacagcggc
aacttctttcctggaaccggcgcccccgatgagtgtgggaatggggcaggtctgggcaag
aacgtcaacatctccttctccggagggttggaaccacccatgggagacgcagagtacatg
gcagccttcagaacggttgttatgccgatcgcggtggagttctcgcctgatctagtgctc
gtgtctgcgggcttcgacaccgcagaaggtcacgccccacaactgggtggctacaaggtc
acgcccaaatgtttcggtcacatgaccaaacaactgatgagtgttgcaggggggcgagtt
gtactggcactggagggagggtatgatcttgcagctatctgcgactgctcagaaatgtgt
gtacaagcactccttggagatgagttgccgcccttgccgaaggaaatcatcgagcagccg
cccaacaaaaatgcagtcacctctctcgaggaaaccatccgccggcagacgccccattgg
tcctcgctgtcgcgatacgccagcacggtcgggtactcgttgtacgaagcctacgagagg
gagaaggaagaggcggacaccgtgagcgcgctcgcgtcactcagtgtggcatcagcgcca
ggagttgggatgccagcatcggccaacagtgagagaaaccataagccccagcccctcgaa
gacaccatcaatggactctaa

DBGET integrated database retrieval system