KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_113999Help
Entry
BRAFLDRAFT_113999 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo04068  FoxO signaling pathway
bfo04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    BRAFLDRAFT_113999
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    BRAFLDRAFT_113999
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BRAFLDRAFT_113999
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 7222574
NCBI-ProteinID: XP_002604137
JGI: 113999
UniProt: C3YI11
LinkDB All DBs
AA seq 223 aa AA seqDB search
MLACVKLTQRVASHPGLLAAAGTRLKHTLPDLAYDYGALEPTISAEIMQLHHSKHHATYV
NNLNVAEEKLAEAQAKGDVTTEIALGPALKFNGGGHLNHSIFWTNLSPNGGGEPQGEVLE
AINRDFGSFENLKKKMSAASVAVQGSGWGWLGYDKENNRLSIAACANQDPLQATTGLIPL
LGIDVWEHAYYLQYKNVRPDYVNAIWNVVSWENINERFLAAKK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgttggcatgtgtcaaactgacccagagggttgcgtcccaccctggtctgctggcggcg
gcaggaacacgactgaagcacaccctgcctgacctggcgtatgactacggagcgctggag
cccaccatctctgcagagatcatgcagctgcaccactccaaacatcacgccacctatgtc
aacaacctcaacgtggctgaggaaaaacttgcagaggcacaagctaagggtgatgtaaca
acagagatagccctaggcccagccctgaagtttaacggaggaggccacctgaaccactcc
atcttctggaccaacctgtctcctaacggaggaggggagccgcagggagaagtccttgag
gcgatcaaccgtgacttcggctccttcgagaacctgaagaagaagatgtcagcagcttct
gtggccgtgcaggggtctggatgggggtggctgggatatgataaagagaataacagactg
agtatcgctgcctgtgctaaccaggatcccctccaagcaaccacaggtctcatccccctc
cttggcatagatgtctgggagcacgcgtactacttacagtacaagaacgtccggccagac
tacgtcaacgccatctggaatgttgttagctgggagaacatcaacgagaggtttcttgcc
gctaagaaatga

DBGET integrated database retrieval system