KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_119381Help
Entry
BRAFLDRAFT_119381 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K18134  EGF domain-specific O-GlcNAc transferase [EC:2.4.1.255]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    BRAFLDRAFT_119381
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bfo01003]
    BRAFLDRAFT_119381
Enzymes [BR:bfo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.255  protein O-GlcNAc transferase
     BRAFLDRAFT_119381
Glycosyltransferases [BR:bfo01003]
 O-Glycan biosynthesis
  O-linked GlcNAc type
   BRAFLDRAFT_119381
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF563 DUF2935
Motif
Other DBs
NCBI-GeneID: 7224280
NCBI-ProteinID: XP_002599698
JGI: 119381
UniProt: C3YVI7
LinkDB All DBs
AA seq 309 aa AA seqDB search
MHWQGLVSRMTSAHIRGKAHTIEETADLFWKEADYGYVWERLQEMTVMCKPQREGDSSLS
CVKHTRYCRATNIYMDFANLDSDNNSNRYAELEMFSSLPFRPIHDDKCDIVLDKPTYLMK
LDAGVNMYHHFCDYINLYASQHINGSFSQDVNIIMWDTLLSAMKSESRLEVRRVDYNWKK
MSFPEQLKVTQNSDLLIGMHGAGLTHSLFLPDWGVLFELYNCEDPRCYKDLARLRGVKYY
TWEKQEKITQTEKGSHPSVGEHAKFVNYGFDPAEFMRIVQNAADYIQGHPQFVAKQNKMN
GSGDRHTEL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcactggcaagggcttgtgagcaggatgacgagtgcccatataaggggaaaagctcat
accattgaggagactgcagacctgttctggaaggaggctgactatggctacgtatgggag
agactacaggagatgacagtcatgtgtaaaccacagcgagagggtgactcgtcccttagt
tgtgtcaaacacacacgatactgcagggccacaaacatctacatggactttgctaacctg
gactcagacaataacagtaacaggtatgcagagttggagatgttttcgtcgctgcctttc
cggccgatccatgatgacaagtgtgacattgtgttggacaagccaacttacctcatgaaa
ctggatgctggtgtgaacatgtaccatcatttctgtgactacatcaacttgtacgcctca
cagcacatcaatgggtctttctctcaggatgtcaacatcatcatgtgggacacgctgctg
agtgcaatgaagtctgaaagcagactggaagtgaggagagtggactacaactggaaaaag
atgtccttcccagaacaacttaaggtaacccagaactcagacctgctgataggcatgcac
ggagctggactcacccattcactgttcttgccagactggggcgtgttgtttgagctttac
aactgtgaggatcctcgctgttacaaagatctggcccgcctgcgtggggtgaaatattac
acatgggagaaacaggagaaaatcacacagacggaaaagggatcccatccaagtgtcggg
gaacatgccaagttcgtgaactacgggttcgaccctgccgagttcatgagaattgtgcag
aatgctgctgactacatccagggccatccccagtttgtagccaaacaaaacaagatgaac
ggaagtggggatcgccacactgagttgtaa

DBGET integrated database retrieval system