KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_126138Help
Entry
BRAFLDRAFT_126138 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00010  Glycolysis / Gluconeogenesis
bfo00051  Fructose and mannose metabolism
bfo00052  Galactose metabolism
bfo00500  Starch and sucrose metabolism
bfo00520  Amino sugar and nucleotide sugar metabolism
bfo01100  Metabolic pathways
bfo01200  Carbon metabolism
Module
bfo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRAFLDRAFT_126138
   00051 Fructose and mannose metabolism
    BRAFLDRAFT_126138
   00052 Galactose metabolism
    BRAFLDRAFT_126138
   00500 Starch and sucrose metabolism
    BRAFLDRAFT_126138
   00520 Amino sugar and nucleotide sugar metabolism
    BRAFLDRAFT_126138
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BRAFLDRAFT_126138
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bfo04131]
    BRAFLDRAFT_126138
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     BRAFLDRAFT_126138
Membrane trafficking [BR:bfo04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    BRAFLDRAFT_126138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 7210519
NCBI-ProteinID: XP_002609112
JGI: 126138
UniProt: C3Y496
LinkDB All DBs
AA seq 450 aa AA seqDB search
MASKEEKIELILKPFRYDNDTLNDIMGRLNKEMEKGLKKETNPDATVKMLATYVRAVPDG
TESGDFLALDLGGSNFRVLHVHIEKGAKDVRLQSDTYAIPESIMTGSGEQLFDYIADCMG
KFLEKIGMKNRKMALGFTFSFPCKQRGLDSASLIKWTKGFNAAGVEGEDVVRLLRDAIKR
RGDFDTDIVAVVNDTVGTMMACGLADHDCLIGLIVGTGSNACYMEKLDNVEIWEGDRGEP
NQVVVNMEWGAFGEDGALDDLLTAYDREIDEHSINKGQQIYEKMISGMYMGELVRLVLLE
MTKQMLLFGGRTSPDLETRGTFLTKYVSEIEEEPIGDMGPTLKILHSLGLKHATETDCVT
VKEVCRAVSTRAAHLVSAGISAIVNKMDRERVAVGVDGSVYKYHPHFKELMTQTIDKLTH
CDVKLMLSEDGSGKGAALVTAVACRLAGNS
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcaaagaggagaagattgaactgatcctcaaaccattccgttacgacaatgac
accctaaacgacatcatgggaaggctcaacaaggaaatggagaaggggctgaaaaaggaa
accaaccctgatgcaactgtcaaaatgctggctacctatgttagagctgtaccagatggg
acagagtccggagatttcctagccctggacctcggtggcagtaacttccgtgtgctgcat
gtccacattgagaagggtgccaaagatgttcgtctacagagcgacacctacgccattcca
gaaagcatcatgactggctctggagagcagctctttgactacatagctgactgcatgggc
aagttcttggagaagatcgggatgaagaataggaagatggcacttgggttcaccttctcc
ttcccctgtaagcagcgagggctggactctgcctcccttatcaagtggaccaaaggcttc
aatgccgcgggcgtggagggggaggatgtggtgcggctgctccgggacgcaatcaagagg
cgtggggactttgacacagatatagttgctgtggtgaatgacacagtggggaccatgatg
gcatgtggtctggctgaccatgactgtctcattgggctcattgtaggcactggcagtaat
gcctgctacatggagaaactggacaatgtggagatctgggagggggaccgtggggagccc
aaccaggtcgtggtcaacatggagtggggggcgttcggagaggatggggcgctcgatgac
ctgctcactgcgtacgacagggagatcgatgaacactccatcaacaagggccaacaaatc
tatgagaagatgatcagtggcatgtacatgggtgagctggtgcgacttgtgctgctggag
atgactaaacagatgctgttgttcggcggtcgcacctcgccagacttggagacacgagga
acatttctgaccaaatatgtttcagagattgaagaggaaccaattggagacatggggcca
acattgaaaatcctgcatagcctgggactgaagcacgctacagagacagactgtgtgacc
gtgaaggaagtctgccgtgccgtgtctacccgcgctgcccacttggtgtctgctgggatt
tctgctattgtcaacaagatggacagggagagggttgcagttggtgtagatggctcagtc
tacaagtatcacccccatttcaaggagctcatgacacagaccatcgacaagctgacacac
tgtgatgtgaagctgatgttgtcggaggacggcagtgggaaaggagcggcgctcgtcact
gctgtggcctgtcgtctggctggcaactcttaa

DBGET integrated database retrieval system