KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_126780Help
Entry
BRAFLDRAFT_126780 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
Organism
bfo  Branchiostoma floridae (Florida lancelet)
SSDB OrthologParalogGFIT
Motif
Pfam: CARD CARD_2
Motif
Other DBs
NCBI-GeneID: 7246392
NCBI-ProteinID: XP_002604621
JGI: 126780
UniProt: C3YGB1
LinkDB All DBs
AA seq 2137 aa AA seqDB search
MKTEYIQALSKQRPALVNEMDPLPVISTMVNKGLLKQRMADYMLPEDVRRQLNERMINAL
PPQGEPAYDILRDTLKGSGQGFLADTIDKTEKKTKGTTEEAVTVHRNLLLQNMQPLPLYR
TLVDSGMVKDADVEELLTKDKKKKLNEKLLTYLTTRSNEGHEAFLGVLRECGQGKQADGL
DQAASTAEKNTEHASNRSSFAQPQAQKTPTSQPAKSPAPATIRKDTKPPSSQPTKPTTPA
NIREDTKPSKMDTTTTLTKREAPTKDKSPLAQSEQKPPGPASPETKRARLEVKPQTNQDA
RRSVSPEKYNVKDFKPGTRIRWRETPQSALGKWGQQLAASQDAPPSNKPGPGEQTSKDEP
SKERESRTQGTRNAPSRAPDKAEPTSLKPQDKISSSPGTTSLGPPERAPPAYSPSYSKPS
SSTPSSSTPSSSTPSNSTPRSYAPSSSTPSSFKASSSEPSSSKPSSSTPSGSKPSSSTPS
SSEPSSSRVQPASDLDARLDRLFSKLDTLESSLTKKPDESHPQSSSPLNRPTTKVEEKTH
SSYSSPSKDMKDSPVRISSPASSRRETSPGQDSYRSPDNWSKSRPDDSFSSYTSSATETP
SRTLPDESFDSYQSPSSNASDDRLPKDSFQSPLSSTTGTPSEKRQEVSSVYSPDRSTSSL
YSKPFSPRTPVDDSPNKTGDSLRHTPTGQSSKKTEEPLSRERPKTTDARTERTPEDSAPA
RDTGTQPFLSPQDEKRYIEKNMDQAAEKLEAKLGEVAPTFKSSYSTTISSPSKTKPPEKP
ARSSTPKVPYEKVRIEKKDDEPVFKPWNKSSSAEATKETTEDPASPTYDRPHRQETPVAN
MHIHDPLISEPIYDVPRDWEQNERQEGTAEDSAPPPLPERTSPSPTKKTSSFTDLFKRKD
KQDEKGQPDKKEKGDNDDEKKRKWVAMFVEAIKTKKKDDSTDTKGVLSDSEEETDKERAD
VDEGKKEKRGGWVRDVVERMKQSKSDDELDTVPEVTSDEERAARKDEQQKVTDKVKEGAK
KAATRTKDTADKAVEATKEGANRAAHAASESWKQLIAGMKGRDEKREQSGDQKKMREEKD
HKSGVTKGPEKTNEHRDDSLPETVVVTEDEAGNVTIESDVSDDLDIDADLEPKQQEKSGW
KLPDWSLRSPKLGRKKEQEYDVDMESPVESETVKEKDDDKKGWKLPNIPDIHLKSPDWKF
RRDKASGSTSEDETPDKANEKRTGRKGWKEFFSTPDIRSPDWMKRDRSPHRDTDPAKEQP
KKEEEEKKGWNFPSVNIKSPDWSFGRDKSPGRSSVSASQEDIMEPEEKKEKRRSKPADEK
TETKEEAKEENQKKWRMPEVHAPNINFKSPDWFGKEETLERAPETESSQKIEEPQEEKEK
KWKMPEFNALPDWKIRRDKSQEKVEDPGTSDTVEEKGEPKEETNKKWKMPEFHAPDIKIP
DSWKIRRDKSQERAEDTESSETEKEGKDPKEEKGKKWKMPEFHAPDIKMPDSWKIRRDKS
QERADDTESSETEKEGKEPKEEKGKKWKMPEFHAPDIKMPDLKIRRGKSQEKVDDTESSE
AGEEKKEPEEGRDKKWKMPEFHAPDFKMPDLKIGRNKSQEKVDDTEPSETVKEKKEPEEG
KDKKWKMPQFNAPDFKMPDWKRNRSQENVEETQSSQELNKPDDEKELDGDKDKWKFPDFR
APDIKAPDWKIRRDKSEERKQGAEAPQDSKEPEDKKDTKKWKMPEFHAPDLNFRRDKSPD
RQKAQEHPTEINGVEEDEDKDKRKWKFPEFRAPDLKGPDWKYGREKSSEETSEAEMTNGE
QEPKVEPKKKKKQTKTWSVPDINLRAPDWKFGSRDDKQRASDEPKEKRKWNLPTMRAPSL
NLRAPGTKPSDEDWPMLARSRRGRDVDDVEKAIYIDRRPREFEDVTLSSADEVNASTENG
SEDSRSAELPQPVADDIKIAAQRLQSTERLLKMLQNMSDKAINHAVKCEPLEDKGQRDLA
DSMSDLRPEELTRKDNLQLLDKMSEELMYLYKHKDVPTSPVPWCMGFSVTMRDVYTTLML
HAISMKASLGDLDKILKLYREELDTAIKEEQAAQSKQKRKKKKTKPSSKSKHLERMKDEE
EKRLKKKGKKSGRSAPKSKDTERTDYYGRDPSFDVEF
NT seq 6414 nt NT seq  +upstreamnt  +downstreamnt
atgaagacggagtacatccaggcgctgtccaaacagcggcccgccctggtgaatgagatg
gacccgttacccgtcatcagcaccatggtgaacaaggggctgctgaagcagcgcatggca
gactacatgctgccggaggacgtgcgcaggcaactcaacgagagaatgatcaacgccctc
cccccacaaggggaaccggcatatgacatcctgagggatacactgaagggcagcggacag
gggttccttgcagacaccatcgacaagacagagaaaaagacaaaaggaacgacagaggaa
gctgtgacggtgcaccgtaacctcctgctacagaacatgcagcccctgccgctgtaccgc
acactggtagactcaggcatggtgaaagatgctgatgtagaggagttgttgacaaaagac
aagaagaagaagttgaatgagaagcttctcacctacctgaccacccgcagtaacgagggt
cacgaggcgttcctcggtgttctgcgggagtgcggccagggcaagcaggcagacggactg
gaccaggcggcgtccacggcagagaaaaacacagaacatgccagcaacaggagtagtttt
gcccaacctcaagcgcagaaaactccgactagccagccggctaagtctcccgccccagca
actatccgcaaggatacgaaacctccatcctcacagcctaccaagcctaccactccagcg
aacatccgtgaggatactaaaccttctaagatggacacaaccaccaccctgaccaaacgg
gaggctccaacgaaagacaagtctcctttagctcagtcggaacaaaaaccaccaggtcct
gcgtctcctgagacgaaacgagcacgattagaagtaaaaccacagacaaaccaagatgca
agacgttcagtgagcccggagaagtataacgtcaaggatttcaaaccagggactcgcata
cggtggcgcgagactccgcaaagtgccttgggaaagtggggacagcaactggcagcatca
caagatgcgcctccaagtaacaaaccagggccaggagagcagacctcaaaagacgagcca
agcaaagaaagagaaagtcgtacccaaggaaccaggaacgctccaagcagagctcctgac
aaggcagagcccacttcccttaagccacaagataagatctcgtcctcaccagggacgacc
agtcttggaccaccagagcgtgcaccaccggcgtattctccttcatattccaaaccaagc
agttccacaccaagcagttccacaccaagcagttccacaccaagcaattccacaccaagg
agttacgctccaagcagttccacaccaagtagtttcaaagcaagctcttccgaaccaagc
agttccaagccaagcagctccactccaagcggttccaaaccaagtagttccacaccaagc
agttccgaaccaagcagctcccgagtacaacctgcgtcagacttggatgccagactggac
aggctattttcaaaactggacaccttggaatcatcgctgacaaagaagcctgatgaatct
catccccaatcctcctctcctttaaacagaccaacaacaaaggtcgaagagaaaactcat
tcctcatactcgtcgccgtcgaaagacatgaaagattcccccgtccgaatctcttccccg
gcctctagcaggcgtgaaacaagtcctggacaggattcgtaccgatcccccgacaactgg
agtaaaagcagaccagacgactctttcagttcgtacacgtcatctgctacagaaacacca
agtcgaacgctgcccgatgagtcgtttgattcataccaatctccatcgtccaacgcttct
gacgacaggcttccaaaagattctttccagtcacctctgtcttcaacgacgggtacacca
agcgagaaaaggcaagaggtcagctccgtttattctcctgacaggtcgacttccagttta
tactcgaagcctttctcccctcggacacctgttgacgatagcccaaacaagacgggagat
tccctccgtcatacccctactggccaaagttcgaaaaagacagaagagcctctcagccgg
gagcggccgaagactacagatgcgcgaactgaaaggacgccggaagactctgcacccgcc
cgagatactggtacgcagccctttctctctccacaagatgaaaaacgttacatcgagaag
aatatggaccaagctgctgaaaagttggaggctaagctaggtgaagtagcacccactttc
aagagttcatacagcactactatcagctccccatctaagaccaaacctccagagaagccg
gcacgatctagcactcccaaagtgccgtacgaaaaagtccgtatcgagaagaaagatgac
gaaccagtttttaaaccatggaacaagagtagttctgcagaagcgactaaagagaccaca
gaagatccagcctctcccacttacgaccgtccacacagacaggagactcctgttgcaaac
atgcatatacatgatccgctcataagtgaacccatctatgacgtcccacgcgactgggag
cagaacgagagacaggaaggcacggccgaggattctgcccccccgccgctacccgagcgg
acttcgccgtcaccgacaaagaaaacttcgtcttttactgacttgttcaagaggaaggac
aaacaagacgagaaaggccaacctgacaaaaaggagaaaggcgacaatgatgacgagaag
aaacgtaaatgggtagccatgtttgtcgaagctataaagacgaagaagaaagacgacagc
actgacaccaagggcgtgttaagcgactccgaagaggagacagataaagaacgagctgat
gttgacgaaggaaaaaaagagaagagaggaggttgggtgcgagatgtcgttgaaagaatg
aagcagagcaaatctgacgacgaactagacactgttccggaggtgacatccgacgaagag
cgcgccgccagaaaggacgagcagcaaaaagtaacggataaggtaaaggaaggcgctaag
aaggctgcaacaagaactaaagacacggccgataaagcggtagaggcaaccaaagaaggg
gccaacagagctgctcacgccgcctcagagagctggaagcagctgatagctgggatgaag
gggcgggacgagaagagggaacaaagcggtgatcaaaagaagatgcgagaagagaaagac
cataaaagcggtgtcacaaagggaccagaaaagacgaatgaacaccgtgacgattcactg
ccagaaacagttgtcgtaacagaagacgaagctggcaatgtcaccattgagtctgacgtt
agcgacgaccttgacatagacgctgaccttgaaccgaaacaacaagagaaaagcgggtgg
aaactacctgactggagtctacgatcacccaagttgggccgcaagaaggagcaggagtat
gacgtggacatggagtctcccgtggaatctgaaaccgttaaagagaaagatgacgacaag
aaaggttggaaacttcccaacattcccgacatccatctcaagagtccggactggaagttc
agacgggataaagcctcgggaagcacatctgaggatgagacgccagacaaggccaatgaa
aagagaactggaagaaaagggtggaaggaattcttcagcaccccggacataaggagtccc
gactggatgaagagagacagaagtcctcatcgtgatacagaccctgctaaagaacagccc
aagaaagaggaagaagaaaagaaaggatggaattttcccagcgtcaatatcaaatccccg
gactggagttttggacgggataaaagtcccgggcgttcatctgtgtccgcgtctcaggaa
gacatcatggagccagaggagaaaaaggagaaaagaagatccaaaccggcagatgagaag
actgaaacaaaggaggaagccaaagaagaaaaccagaagaaatggagaatgcctgaggta
catgcacctaacataaacttcaaatcccccgattggtttgggaaagaagagacactagaa
agggcaccagagacagaatcgtcccagaaaattgaggaaccacaggaagaaaaggaaaag
aaatggaaaatgccagagttcaatgcactccctgactggaagatacgacgggataaaagt
caggaaaaggtggaagaccctggcacttcagataccgtggaagagaaaggggaaccaaaa
gaagaaacaaataaaaagtggaagatgccggaattccatgcacctgacattaaaatacct
gactcatggaagataagacgagataaaagtcaggaaagggcagaagacaccgaatcttcc
gaaacagagaaagaaggaaaggatccaaaagaggaaaagggcaagaagtggaagatgccg
gaattccatgcacctgacatcaaaatgcctgactcatggaagataagacgagataaaagt
caggaaagggcagatgacaccgaatcttccgaaacagagaaagaaggaaaggaaccaaaa
gaggaaaagggcaagaagtggaagatgccggaattccatgcacctgacatcaaaatgcct
gacttgaaaataagacgaggtaaaagtcaagaaaaggtggatgacaccgaatcttcagaa
gcaggggaagaaaagaaggaaccagaggaaggaagggacaagaagtggaagatgccggaa
ttccacgcacctgactttaaaatgcctgacttgaaaataggaagaaataaaagccaggaa
aaggtggatgacactgaaccgtcagaaacagtgaaggaaaagaaagaaccggaggaagga
aaggacaagaagtggaagatgccacaattcaatgcacctgacttcaaaatgcctgactgg
aaacgaaacagaagtcaagaaaatgtggaagagactcagtcttctcaagaacttaacaag
ccagacgacgaaaaggaattagatggcgataaagataagtggaagttccctgacttccgt
gcaccagatatcaaagcccccgactggaaaatacgaagagataagagtgaagagagaaag
cagggggctgaggctccacaggatagcaaggagccggaagacaaaaaggacactaaaaag
tggaagatgcctgagtttcatgcacctgacctgaactttagaagagataagagtcctgac
agacagaaagcacaagaacatccgacagaaatcaacggcgtggaggaggatgaagataag
gacaagaggaagtggaagttcccggagtttcgtgcccctgacctcaagggtccagactgg
aaatatgggagagagaagagttcagaggaaacatctgaagctgaaatgacaaatggagag
caggaacctaaagttgagcccaagaagaaaaagaaacagacaaagacctggagtgttcct
gatatcaacctgagggccccagactggaagttcggctcgagggacgacaaacagcgtgcc
tctgatgagcctaaggagaagaggaagtggaaccttcccaccatgagggcaccgagctta
aacctgagggctccaggcacgaagccatctgatgaagactggccgatgctggcccggagt
aggcggggaagagatgttgatgatgtagagaaggcgatatacatcgacaggaggccgaga
gagttcgaagatgtgacgctgagttctgcagacgaagtgaacgccagcactgagaacggg
agtgaggattcgaggtctgctgagttgccccagccggtagcagatgacatcaaaattgca
gctcaacgtcttcagagtacggaaaggctactgaagatgctgcagaacatgtcggacaag
gccatcaaccatgcagtcaagtgcgagccgctggaggacaagggacagcgggacttggcg
gactccatgtctgatctgcggcctgaggaactaacacggaaagacaatctccagttgctg
gataagatgtctgaggagctgatgtacctgtacaagcacaaggacgttcccaccagtccc
gtgccgtggtgtatgggcttcagtgtcaccatgagggacgtctacaccaccctcatgctg
cacgccatctccatgaaggcgtccctgggggatctggacaagattctcaagctctacaga
gaagaactagatacagctattaaagaagagcaagcagcacaatcgaagcaaaagaggaaa
aagaagaagacaaaaccatcatcaaagtcaaaacacttggagagaatgaaagacgaggaa
gaaaaacggttgaagaagaagggaaagaagagtggtagatcagcaccaaagtccaaagac
actgagaggactgactactacggacgggaccctagctttgatgtggaattctaa

DBGET integrated database retrieval system