KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_126922Help
Entry
BRAFLDRAFT_126922 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00240  Pyrimidine metabolism
bfo00983  Drug metabolism - other enzymes
bfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BRAFLDRAFT_126922
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    BRAFLDRAFT_126922
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BRAFLDRAFT_126922
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-GeneID: 7245286
NCBI-ProteinID: XP_002603612
JGI: 126922
UniProt: C3YJC5
LinkDB All DBs
AA seq 196 aa AA seqDB search
MMLGATAVLEGGQDICSVDLVTKPPRKGRSRTELVRRIQRYKIAKQSCVLIKYAGDDRYD
KDGIATHDRYVTEAVATTKLYDIKDDVLSCQVIGVDEGQFFPDVVPFCDEMANQGKTVIV
AALDGTFQKKGFGDILNLVPLAESVIKLQAVCMSCYNHASYTKRLGQETKVEVIGGCEKY
MAVCRDCHQLSPSKIV
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgatgctcggagctacagctgtgctcgagggtggtcaagatatttgcagcgtggacttg
gtgactaaaccgccgagaaagggaagatccaggactgagcttgtgcgaaggattcagcgc
tataagatagccaaacagagttgtgtcctgatcaagtatgcaggagatgaccgatacgac
aaggatggcatagccactcacgacaggtatgtgactgaagctgtggctacgaccaaatta
tatgacatcaaggacgacgtgttgtcttgccaggtgatcggggtcgacgaaggccagttt
ttcccagatgttgttcctttctgtgatgaaatggcaaatcaaggcaagactgttattgtg
gctgctctggatggaacattccagaaaaagggttttggtgacatcttgaaccttgttcct
ctggctgagagtgtgatcaaactgcaggcggtgtgtatgagctgctacaaccacgcatcc
tacacaaaacgactgggacaggaaacaaaggtagaagtgattggtggctgtgaaaagtac
atggcagtttgtcgtgactgtcaccagctgtcccccagtaagatagtt

DBGET integrated database retrieval system