KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_128477Help
Entry
BRAFLDRAFT_128477 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00020  Citrate cycle (TCA cycle)
bfo00190  Oxidative phosphorylation
bfo01100  Metabolic pathways
bfo01200  Carbon metabolism
Module
bfo_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BRAFLDRAFT_128477
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BRAFLDRAFT_128477
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BRAFLDRAFT_128477
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 7250842
NCBI-ProteinID: XP_002602350
JGI: 128477
UniProt: C3YMM1
LinkDB All DBs
AA seq 668 aa AA seqDB search
MAAALRLGALAGRILSNSQASGLSHGVKPLATSRSFHFTIEGRRSDAKLSEGNVGTNNYP
VVDHTYDAVVVGAGGAGLRAAFGLASEGFKTACITKLFPTRSHTVAAQGGINAALGNMEP
DNWRWHMYDTVKGSDWLGDQDAIHYMTEEAPQAVIELENMGMPFSRTEDGKIYQRAFGGQ
SYDYGKGGQAHRCCCVADRTGHSLLHTLYGQSLRYDTEYFVEYFALDLIMKDGECIGVIA
INMEDGTIHRFHAKNTVLATGGYGRAYFSCTSAHTNTGDGTAMVTRAGLANQDMEFVQFH
PTGIYGAGCLITEGCRGEGGYLINSEGERFMERYAPTAKDLASRDVVSRSMTIEIREGRG
CGPEKDHVYLQLHHLPPEQLAARLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVPTN
YKGQVVQHDSEKGDYIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACAHTIRDEN
KPGEAIADLPKHAGEESVANLDAVRYANGSVPTADLRLQMQKTMQAHAAVFRTGDVLKEG
CDKISELVNKMDDIKTFDRGVVWNTDLIETLELQNLMLNAAQTMFSAENRKESRGAHARE
DFKDRIDEYDYSKPVDGQKARPAADHWRKHTLCKMDDGKTVDLSYRPVIDETLDEQDCKH
VPPAIRSY
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgctctgaggttgggcgctcttgccggcagaattctgtcaaattctcaggca
tcaggattgagtcatggagtcaagcccctggctacatccagatcgttccacttcaccata
gaggggagacgcagcgatgcaaaactctcagaaggcaatgtgggcacaaacaactacccc
gttgtggaccacacgtacgatgccgtggtggttggagccggcggggctggtctccgagcg
gcgttcggtctggcgtcggaaggcttcaagaccgcctgtatcactaaactgttccccacc
agatctcatactgtggctgctcagggtggtatcaatgcagcactggggaacatggaacca
gacaactggagatggcacatgtacgacacagtgaagggctctgattggttgggagaccag
gatgcgatccactacatgacagaggaggcaccacaagctgtcattgagttggagaacatg
ggcatgccgtttagccgtacagaagacgggaagatttaccagcgagcgtttggcgggcag
agttacgactacgggaagggtggacaggcacacaggtgctgctgtgtggccgaccgaact
ggacactccctcctgcacaccctgtatggacagtccctgaggtatgacacggagtacttt
gtggagtattttgccctggacctgatcatgaaggacggagagtgtatcggagtcatcgcc
atcaacatggaggatggaaccatccaccgcttccacgccaagaacaccgttctcgctacc
ggcggttacggccgcgcctacttcagctgcacgtcggcacacacgaacacgggcgacggt
accgccatggtaacccgcgctgggctggccaatcaggacatggagtttgtgcagttccac
ccaacaggtatctacggcgctggttgcctgatcactgagggttgtcgtggcgagggcgga
tacctcatcaacagcgagggcgagcgcttcatggagcgctacgctcccaccgccaaggat
ctcgcttcccgtgacgtggtgtcccgctccatgactatcgaaatcagagagggaagaggg
tgtggtccggagaaggaccatgtgtacctccagctgcaccacctcccgcccgagcagctc
gcggcgcgcctccccgggatctccgagaccgctatgatcttcgctggcgtcgatgtgacc
cgtgaacccatccccgtcctccccactgtacactacaacatgggaggtgtgcctactaac
tacaagggacaggttgtacaacatgactcggagaagggtgactacattgttccgggtctg
tacgcgtgcggagaagcagcctgcgcctccgtgcacggggccaaccgtctgggcgccaac
tcgctcctggatctggttgtgttcggccgtgcgtgcgctcacaccatccgcgatgagaac
aagcccggagaggccatcgcagacttgcctaagcatgcgggagaggagtctgtagcaaac
cttgatgctgttcgttacgcaaacggcagcgtccccacagctgacctcagactacagatg
cagaagaccatgcaggcccatgccgcagtgttccgtaccggtgatgttctgaaggaagga
tgtgacaagatcagtgaactggtcaacaagatggacgatatcaagacgtttgaccgcggt
gtcgtgtggaacactgacctgattgagaccctggagctccagaacctgatgctgaatgct
gcacagaccatgttctctgctgaaaacaggaaggagagtcggggagcacacgcacgggag
gacttcaaggaccgtattgacgagtatgactactccaaacctgtggatggacagaaggca
cggccagcggctgaccactggagaaaacataccctgtgtaaaatggacgatggcaaaact
gttgacctgtcctacagaccagtcatcgatgaaacattggacgaacaggactgcaagcat
gtcccaccagccatccgctcctattaa

DBGET integrated database retrieval system