KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_129781Help
Entry
BRAFLDRAFT_129781 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K11253  histone H3
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Chromosome and associated proteins [BR:bfo03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    BRAFLDRAFT_129781
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BRAFLDRAFT_129781
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF CENP-T_C CENP-S TFIID_20kDa TFIID-31kDa YscO-like PAF DUF1931
Motif
Other DBs
NCBI-GeneID: 7256081
NCBI-ProteinID: XP_002595193
JGI: 129781
UniProt: C3Z881
LinkDB All DBs
AA seq 252 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERAGKAAKKAGKARPAGDKKRGRRRKRRETFGVYIYKVLKQVHPDTG
VSSKAMGIMNSFVNDIFERIAAEASRLAHYNKRSTISSREIQTAVRLLLPGELAKHAVSE
GTKAVTKYTSSK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtaccaagcagaccgcccgtaaatccaccggtggcaaggcccccaggaagcag
cttgccaccaaggctgcccgcaagagcgccccggctaccggtggtgtcaagaagcctcac
cgctacaggcccggtaccgtggccctgagagagattcgtcgctaccagaagtcgacggag
ctgctcatccgcaagctgcccttccagcgcctggtgcgagagatcgcacaggacttcaag
accgacctgcgcttccagagctcggcggtcatggccctgcaggaagccagcgaggcctac
ctggtcggtctcttcgaggacaccaacctgtgcgccatccacgccaagcgtgtcaccatc
atgcccaaggacatccagctcgcacggcgcatccgaggggaacgcgctggaaaagctgct
aagaaagctggcaaagccaggcccgccggagacaagaagcgcggaaggaggagaaagaga
agggaaaccttcggtgtctacatctacaaggtgctgaagcaggtgcaccccgacaccggt
gtctctagcaaggccatgggcatcatgaactctttcgtcaacgacattttcgagcgcatc
gccgccgaggcttctcgtctggctcactacaacaagcgctccaccatcagcagccgcgag
atccagaccgccgtgcgactcctgctaccgggcgagctggccaagcacgccgtcagcgag
ggcaccaaggcagtcaccaagtacaccagctccaagtag

DBGET integrated database retrieval system