KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_194124Help
Entry
BRAFLDRAFT_194124 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00052  Galactose metabolism
bfo00500  Starch and sucrose metabolism
bfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BRAFLDRAFT_194124
   00500 Starch and sucrose metabolism
    BRAFLDRAFT_194124
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BRAFLDRAFT_194124
    3.2.1.20  alpha-glucosidase
     BRAFLDRAFT_194124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 7215655
NCBI-ProteinID: XP_002600956
JGI: 194124
UniProt: C3YS63
LinkDB All DBs
AA seq 600 aa AA seqDB search
STPVQTVTLDVEHQTNNRLRFKFYDQSSLRYEVPMDMPGPETAASPEYEVGIPDSGHFYI
NVTRRDTGTVIWDSSLGGFTFADQFLQISTKLPSRYVYGFGEHEHATFHHDLNWRTWGML
TRDESPGPVKRNNYGVHPFYMAMEEDGNAHGVLLLNSNPQGDVTFQPKPALTFRTIGGLL
DFYMFLGPSPEEVVQQYTQAIGRPFMPPYWSLGFQLCRYGYKNLEHIQNVVDGMRNYNIP
QDVQYADIDYMERQLDFTLDHTNFHGLPAYFRQLQDEGMKTIIILDPAISKNETNYPAWD
RGVQMDVWIKNEDQSGPAYGKVIIFYHPQNYRSLVGFPDFLKPSTHDWWHEQIVDFYNDP
TEGIRFDGIWIDMNEPANFIPGNYDPTTNSGKCENNIWNNPDYTPWVMGDLYSKTICMDA
HQEGTDGTTYRHYDVHNLYGWSQTPTTLRQVYQNIKDCNYDKTIVVTRSTFPGSGKSGGH
WLGDNTSKWDHLHKSIIGMLEFNLFGIPYIGADICGFWGEPDREMCWRWMQLGAFYPYSR
NHNQKDVIAEQDPSAWGPEFAEASRAVLLTRYRLLPYLYTLFYEAHTKGSTVVRPLLHEY
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
agcacaccggtccagaccgtcacactagacgtggaacaccaaaccaacaacagactgcgt
tttaagttttatgatcagagcagcctgcggtacgaggttcccatggacatgcccggtcca
gaaacggcagcctctccagagtatgaggtcggaattccagattccggacacttttacatc
aacgtaactcggagggacaccggcactgtcatttgggactcttccctcggtggcttcacc
ttcgcagaccagttccttcagatctccaccaagctgccgtcccggtacgtgtacgggttc
ggggaacacgagcacgccacgtttcaccacgacctgaactggcgcacgtggggcatgctg
acacgggacgagtcaccgggaccggtaaagcggaacaactacggggtacatcccttctac
atggctatggaggaggacgggaacgctcacggcgtgctgctactcaacagcaatccgcaa
ggtgacgtgacgttccaacccaagcctgccctgacgttccgtacgatcggcggtttgctg
gatttctacatgttcctgggacctagtccggaggaggtagtgcagcagtacacacaggcg
attggaagaccgttcatgccgccatattggtctctgggcttccagctctgtcgctatggt
tacaagaatctagagcatatccagaatgtcgtcgacggcatgaggaactacaatattcca
caggatgtgcagtacgctgatatagactacatggagcgtcagctggacttcactcttgac
cacaccaactttcacggcctccctgcctacttcagacagctgcaggacgaagggatgaaa
actatcatcattttggaccccgctatcagtaagaacgagaccaactacccagcctgggac
aggggtgtccagatggacgtatggataaaaaacgaggaccagagtggacctgcctacggg
aaggttatcatattttatcatccacagaactaccgttcgctggttggttttcctgacttc
ctgaagccgtccactcacgactggtggcacgaacagattgttgacttctacaacgacccg
acagaaggcatcagatttgacgggatatggatcgacatgaacgaacccgctaacttcatt
cccggaaactacgacccgacaaccaattccgggaagtgtgagaacaacatatggaacaac
cctgactacacgccttgggtgatgggtgacctgtacagtaagaccatctgtatggacgca
catcaggagggtacagacggcactacttacagacactacgatgttcacaacctgtacggc
tggagtcagacgcctactacactcaggcaagtatatcagaatattaaagattgcaactat
gataaaaccatcgttgtgaccaggtccaccttccccggcagcggcaagagcggaggacac
tggctgggcgacaacaccagcaagtgggaccacctccataagtctatcatcggtatgctg
gaattcaacctctttggaatcccatatatcggtgcagatatctgcgggttctggggcgag
cctgaccgtgagatgtgttggcggtggatgcagctcggagcgttctacccttacagccgc
aaccataaccagaaggacgtcatagcggaacaagacccgtccgcatggggtccggagttt
gccgaagcttcccgggcggtgctgttaacccgttaccgcctactgccctacctctacacg
ctcttctacgaggcgcacactaaagggtctactgttgttcgcccgctgttacacgagtac

DBGET integrated database retrieval system