KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_208062Help
Entry
BRAFLDRAFT_208062 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K10846  DNA excision repair protein ERCC-5
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    BRAFLDRAFT_208062
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bfo03400]
    BRAFLDRAFT_208062
DNA repair and recombination proteins [BR:bfo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     BRAFLDRAFT_208062
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_I XPG_I_2 Agglutinin_C 5_3_exonuc
Motif
Other DBs
NCBI-GeneID: 7232084
NCBI-ProteinID: XP_002607562
JGI: 208062
UniProt: C3Y7R7
LinkDB All DBs
AA seq 162 aa AA seqDB search
TPGNLAEVEQDLQTERRTLQAQQARQEKLAASITEQMYVESQELLRLFGIPYVQSPTEAE
AQCAFLDQSKQTEGTITDDSDVWLFGGRQVYKNFFSQQRDMEVFKYKDVVSQLAMDRSRL
INFALLTGSDYTEGIQGVGKVLAMEVLQEFPGEGIAALQAFR
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
accccaggtaacctggcggaagttgagcaggacctgcagactgagaggagaaccctacag
gcacagcaggctcggcaggagaaactagcagcctccatcacggagcagatgtatgtggag
agtcaggagttactgcggctgtttggcattccgtacgtccagagcccgacagaagctgag
gcgcagtgcgctttcctcgaccaatcaaaacagacggagggcaccataactgacgacagt
gacgtgtggttgttcggggggcgacaagtttacaaaaacttcttcagccagcaacgagac
atggaagttttcaagtacaaggatgttgtttcacaattagcaatggaccggtccaggctg
attaactttgccctgcttactggaagcgactacacagagggtatccagggggtgggcaag
gtgctggccatggaggttctacaggagttcccaggggagggcatcgctgccttacaggct
ttcaggtaa

DBGET integrated database retrieval system