KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_210089Help
Entry
BRAFLDRAFT_210089 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K01594  sulfinoalanine decarboxylase [EC:4.1.1.29]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00430  Taurine and hypotaurine metabolism
bfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BRAFLDRAFT_210089
Enzymes [BR:bfo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.29  sulfinoalanine decarboxylase
     BRAFLDRAFT_210089
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2 Aminotran_5 SepSecS
Motif
Other DBs
NCBI-GeneID: 7235281
NCBI-ProteinID: XP_002593084
JGI: 210089
UniProt: C3ZED9
LinkDB All DBs
AA seq 479 aa AA seqDB search
SVNKFLHDVFDTVLEDVLKKSTSAASKVIDFLPPEELSKRIDLELRDDPEPHESLLDHCK
KTIQHSVKTGHPMFLNQLYQGMDPYGLAGQFVSDSLNTNLHTFEAAPVFVLMEQEVVRKV
CSLIGWPAGDGLMGAGGSMLNMFGINLARHKYFPDLKKTGMHGGPRLVLLTSAESHYSMT
KGAGFLGIGTDNVIKVKCDERGQMLPEELDRAIEDAKSQGSVPFCVNATSGTTVTGGYDP
LGAIADVCQKHRLWLHVDAAWGGSVLTSRKHRGLMAGVERADSLLWNPHKMLSLPLQCSV
FVTREQGLLKAAHASGATYLFQKDKISYDASYDVGDKSIQCGRKTDPMKFWLSWKAHGTR
GFEQHVDYVFELAQYLYDKLLSRKDFKMVLPGPNCTNVCFWYIPPSLQGMPEGPEFTKKL
DQVAPVIKDRMTKNGNMMVQYQPLDGVPNFFRLVLANTETTRQDLDFFVEEIERLGADL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
tccgtcaacaagttccttcacgatgtcttcgataccgtcttggaagacgtcctcaagaag
agcactagcgcagcgtcaaaggtcatagattttctccctcccgaagagctgagcaagagg
atagacctggagttacgggacgatccagagcctcatgagtctctcctggaccactgcaag
aaaaccatccagcacagcgtcaaaacgggtcacccgatgttcctgaatcagctgtaccag
gggatggacccgtacggactggcgggccaattcgtcagcgactccctcaataccaacctg
catacctttgaagcggcgcccgtcttcgtgctgatggaacaggaagtggtcagaaaggtc
tgcagcctgattggctggcccgcgggagatggccttatgggagcaggcggttccatgctg
aacatgttcggtatcaacctggctagacacaagtactttcccgacctgaagaagaccggg
atgcacggtgggccgagactggtgctcctcacgtcagccgagagccactactccatgacg
aagggcgcggggtttcttgggatcggaactgacaacgtcatcaaggtcaagtgtgacgaa
agggggcagatgttaccggaggaactggatagagcgatcgaagacgccaagtctcagggt
tccgtgccgttttgtgtgaacgccaccagcggcaccacggttaccggggggtacgacccg
ctgggcgccatcgcagacgtctgtcagaaacacaggctctggctgcacgtggatgctgcc
tggggaggctccgtactgacctcgcggaaacaccgcggcctgatggcgggggtggagcgg
gcagactcgctgctgtggaacccgcacaagatgctgtccctcccgctgcagtgctccgtc
ttcgtcaccagggaacagggtctcctgaaagcagcccacgcgtccggcgccacgtacctg
ttccagaaagacaagatttcctacgacgccagctatgacgtcggcgacaagagcatacag
tgcggcaggaagacggacccgatgaagttctggctctcctggaaggcgcacgggaccagg
gggttcgaacaacacgtggactacgtcttcgagctggcacagtacctgtatgacaagctg
ctcagtaggaaagactttaagatggtgcttccagggcccaactgcacgaacgtgtgtttt
tggtacataccacccagtctgcaggggatgccagagggaccagaattcaccaagaagcta
gatcaggtggccccagtcatcaaggaccgtatgaccaaaaatggcaatatgatggtccag
taccaaccgctagatggcgtgcctaacttcttccgcctagtgttggccaataccgagacg
acacgtcaggatctcgacttcttcgtggaggaaatcgaacgtcttggggcggacctgtag

DBGET integrated database retrieval system