KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_217436Help
Entry
BRAFLDRAFT_217436 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K11182  diamine oxidase [EC:1.4.3.22]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00330  Arginine and proline metabolism
bfo00340  Histidine metabolism
bfo00380  Tryptophan metabolism
bfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BRAFLDRAFT_217436
   00340 Histidine metabolism
    BRAFLDRAFT_217436
   00380 Tryptophan metabolism
    BRAFLDRAFT_217436
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.22  diamine oxidase
     BRAFLDRAFT_217436
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu_amine_oxid Cu_amine_oxidN3 Cu_amine_oxidN2 DUF1965
Motif
Other DBs
NCBI-GeneID: 7211248
NCBI-ProteinID: XP_002597698
JGI: 217436
UniProt: C3Z111
LinkDB All DBs
AA seq 728 aa AA seqDB search
MATEAVDEDSPALYDDLTAEELRAVREYLLGQSGLDITPWEEASINDNYIYGMELHLPLK
AEALAYLDNNGPRPERQALVTVYGGGRTQPVVEQYVVGPLPDPTRHETYAPPGRKNPIPW
HARAPETKEYALLIPMLTQATKETDRILKESFGYTYYNCSSRCLTLGDTAPRGFTSGERR
TWFRFMRNLEGKFLHPVGFMIQINHLNMDPAQWRIERVFYNGQYFESTAELVRSYDDGTA
RKAQLPVLAGDEALFSSFRRRGDPQPSRPLRAPELIEPDGRRYKVQGRHVEYMGWSFNWR
LSTTQGLQLYDIRMKNERVVYELGLQDAGTWYSGTDPLMLAALYVDNAWPVAGSFELLPG
IDCPKTATFFDALHQQDIGKPRRFRNAVCAFELDTGIPLRRHFDSDDAGGYTFYGGMADH
VLVLRHINVVYNYDFVYDYIFHQNGVLEVKVSLTGYLQPTFYTQDQDPYGYRMWANQIGN
HHQHFFNYKVDLDVVNVQNRFETVDILLENITNPERPELRHIQTRIQRSLRTTEKEAAVQ
YDFNRPKYYNFYSEEQKNRFDAHRGYRLQLNGIAKSLLPRGEWAPVNGAAWMDYQVAVTR
RKDSEPSSSSIFNQNDLYDPVVNFQSFIDDDENIVDEDLVAWVTLAAHHLPHSEDYPVTA
TAGNQLQFFIRPFHFYDEDPSVASSNAVRITPSDDFRSATVDRFGTPEMTSCFPRTSPVS
FNGTWREV
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atggctacagaggcggttgacgaggactccccggccctgtacgacgatctgaccgccgag
gaactgagggcggtacgggagtatctcctgggacagtcgggccttgatatcacaccatgg
gaagaggcttccatcaacgataactacatctacggaatggagcttcatcttccactcaag
gccgaagcgttagcgtacctggacaataacggcccccggccggagagacaagccctagtg
acggtgtacggtggcggcaggacgcagcccgtggtggaacaatacgtggtcgggcccctc
cccgacccaacccgccacgagacatacgcaccgcccggtaggaagaaccccatcccgtgg
cacgcccgtgctccggagacaaaagagtacgccctgctcataccgatgctgacacaggca
acgaaggaaactgacagaatcctcaaggaaagtttcggatacacatactacaactgcagt
tcccggtgtctgacgctaggtgacactgcaccacgggggttcactagcggggagaggagg
acctggttccgcttcatgagaaacctggagggcaagtttctgcatccggtggggttcatg
atacagataaaccacctcaacatggaccctgcccagtggcgtatagagagagtcttctat
aacggacagtacttcgagtccacggcggagctggttcgaagttatgacgacggcacagcg
cggaaagcacagcttccagtcctcgctggtgacgaggctctcttctcgtctttccgccgc
cggggcgacccacaaccctcccggccactccgagcgcctgagctgatagagcccgatggt
cggcggtacaaggtacaggggcgccatgtggagtacatggggtggagttttaactggagg
ctgagcaccacgcagggactacaactgtacgacatacggatgaagaacgagcgcgtggtg
tacgagctgggtctccaggacgcaggcacgtggtactccgggaccgacccgctcatgctt
gccgcgctgtacgtcgacaacgcctggcccgtagcgggctccttcgagctccttcccggt
atagactgtcccaagacggcgacgttcttcgacgcgctacaccagcaagacatcggcaag
ccgcgccgcttcagaaacgccgtctgcgccttcgaactggacactgggatacccctccgc
cgccattttgattccgacgacgccggcggctataccttttatggtggcatggctgatcac
gtgctcgtcttacgtcacatcaacgtggtctacaactacgactttgtctacgactacata
ttccaccagaatggagtactagaggtcaaagtgagcttgacgggatatctccaacccaca
ttctacacacaagaccaggatccgtacggctaccgaatgtgggccaatcagatcggaaac
catcaccaacacttcttcaactacaaggtggatctagatgttgtcaacgtccaaaatagg
ttcgagacagtggacatcctgttggagaacatcaccaaccctgagcggccggaactgcgc
cacatccagacccgcatccagcggagcctcagaactaccgagaaggaagccgccgtgcag
tacgactttaacaggcccaagtactacaacttctacagcgaagaacaaaaaaaccggttt
gacgcccaccgcgggtaccgtctccaactgaacgggattgctaagagcctgttaccccgg
ggagagtgggcacccgtcaacggcgcggcgtggatggactaccaggtggccgtcacccgt
cggaaggactccgagcccagcagctcctccatcttcaaccagaacgacctgtacgacccc
gtggtcaacttccagtccttcatcgacgacgacgagaacatcgtggacgaggacctggtg
gcgtgggtcaccctggcggcgcaccacctcccccactccgaggactaccccgtcaccgcc
acggcagggaaccagctgcagttcttcatccgaccctttcacttctacgacgaggacccc
tcggtggcctcgtctaacgccgtccgcatcaccccgagtgacgactttcggtcggctacc
gtcgacaggttcggcacaccggaaatgacgtcatgctttccgaggacaagccctgtctca
tttaatggcacgtggcgcgaagtctaa

DBGET integrated database retrieval system